DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and RAI1

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_011268.1 Gene:RAI1 SGDID:S000003215 Length:387 Species:Saccharomyces cerevisiae

Alignment Length:262 Identity:39/263 (15%)
Similarity:89/263 (34%) Gaps:74/263 (28%)


  Fly    66 RYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKT 130
            ::||.....|.:.:  |..:|:.||||       ..::..::||:|:....:...::...::..:
Yeast    65 KFKDYYKDFEDRCS--LRGLLETIESS-------ERHKGKKINADIITFRGIARKLISCAFDSPS 120

  Fly   131 --GWSLGVTRYRNTMYICRIDVEQPDPIDQ----------DNLKRAMQEFWLRNLRTHCVFENGI 183
              ...|.:..:...::|    .|.|:.::.          .|:.:.:..|......|.....|.:
Yeast   121 FNTVDLRIVSFNGQLFI----KEVPEAVNAAKASSATEAGRNINQDLNVFTGYKFETLATLSNPL 181

  Fly   184 KMHQHN--QSSEEHLRFHG------------------------VFSFDLNGNRVLFDSPVLAEMP 222
            :.....  :...:.:..||                        :|.|..||              
Yeast   182 QYTPREVIEKRTKRIVSHGDEYISVVRTGVGNCKLILGAEVDCIFDFKENG-------------- 232

  Fly   223 STTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEK 287
                ..:...:.:|:......:..|..:..| :..:.|::|||:||..:....:|:    |.:.|
Yeast   233 ----RDNLKHYAELKCTQQVANISDTHKFER-KLFRTWLQCFLVGIPRIIYGFKDD----HYVLK 288

  Fly   288 TL 289
            |:
Yeast   289 TV 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 8/27 (30%)
RAI1NP_011268.1 RAI1 222..289 CDD:312244 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167497714
eggNOG 1 0.900 E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.