DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and C37H5.14

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001300056.1 Gene:C37H5.14 WormBaseID:WBGene00045308 Length:322 Species:Caenorhabditis elegans

Alignment Length:376 Identity:70/377 (19%)
Similarity:138/377 (37%) Gaps:109/377 (29%)


  Fly    35 FAWSPIGQFEPNSQKVPYVVVPPSIKFPISL---RYKD-------SPPKLEKKPNIF-------- 81
            |..:|:|.:..|::.          ::.|.|   |:|.       ....|::..|.|        
 Worm     5 FKLAPVGDYWANNEN----------RWNIELGRHRHKQLLINHAAIGMNLDEGYNNFENEHGGER 59

  Fly    82 LDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLG--VTRYRNTMY 144
            ::::|.||..::.:.:.::.    .:.|:|||...:|..:....|   ||..:.  ..|:|..::
 Worm    60 IESILAYIMKTARIGIPLKE----MIEADIVCRRGLLRNLSINKY---TGHYINFYAVRHRGVIF 117

  Fly   145 ICRIDVEQPD----PIDQDNLKRAMQEFWLRNLRTHCV-FENGIKMHQHNQSSEEHLRFHGVFSF 204
            :|    |..|    |   |.|:|||.         |.: |||.:.:.|               |.
 Worm   118 LC----EDKDFGGAP---DKLRRAMY---------HTLKFENVMTVPQ---------------SR 151

  Fly   205 DLNGNRVLFDSPVL-----------------AEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHN 252
            |:..:|......|:                 |::....:.||.:.:..:. :|:   ...| :.|
 Worm   152 DITASRKEATKMVIRGCLEKEGAESIRLFYAADIDCLDIYGSPVEFKSIS-KPL---ETGW-DKN 211

  Fly   253 RTEALKWWVKCFLLGIESLYIARRDEN-----AHVHNIEKTL-VRDLWKSCEKDWSPTVCANFMI 311
            ||.|  |:::||...:.::.:..|..:     .|.....||: |...:......|:...|...:.
 Worm   212 RTMA--WYMQCFFASVNTIVVGERQRSRLRTVRHYRKSIKTMNVEAFYTHRNHSWTRESCIEQLY 274

  Fly   312 YLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRM 362
            ..|:.:...|: :|..:    .:|....|| :|.......:|....::.|:
 Worm   275 GTLSFVKHHMS-LDGMA----LKFSVINGT-NYLATTQYGEYIVPQNFLRV 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 5/32 (16%)
C37H5.14NP_001300056.1 RAI1 <195..240 CDD:285815 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1034620at2759
OrthoFinder 1 1.000 FOG0002356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.