DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and dxo

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_021330453.1 Gene:dxo ZFINID:ZDB-GENE-040718-286 Length:404 Species:Danio rerio

Alignment Length:376 Identity:83/377 (22%)
Similarity:153/377 (41%) Gaps:52/377 (14%)


  Fly    23 FPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPP-----SIKFPISLRYKDSPPKLEKKPNIFL 82
            ||...:|:..|.|:......|..:.:::.|.|.|.     :::...:.|:......:::|    |
Zfish    54 FPLYKQPLEVGCFSLDARRNFFNDHRQLRYYVEPRRSPDFNLRDGYTSRFIKRDDGVKEK----L 114

  Fly    83 DNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICR 147
            |:||::|..:.:. :...|:....|..:.|.....|..::..|||.:.||.:...::|.::||..
Zfish   115 DHMLRWILENRHK-MQNSNSSSCALGVDFVTWRGHLTKVLTTPYETQEGWMMAACKFRGSIYISE 178

  Fly   148 IDVEQPDPIDQDNLKRAMQE---FWLRNLRTHCVFENGIKMHQHNQSS------------EEHLR 197
            ::.||.....:...:|  ||   :|            |.|..|:..:.            ..:..
Zfish   179 VETEQARENRETRSER--QEEMMYW------------GYKFEQYTCADGADGTPDPGGVVNTNEA 229

  Fly   198 FHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVK 262
            |..|....|..:::||...|...:.......:...:|:|:......:.......:|.:.||||.:
Zfish   230 FCTVVQTRLADHKLLFSGEVDCRLKDPDAPPAPGCYVELKTSAEICTPKQRSNFHRYKLLKWWAQ 294

  Fly   263 CFLLGIESLYIARRDENAHVHNIE---KTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPI 324
            .||.|:..:....||.:..|.::|   .:.:..:.|:....|.||||.||....|..:..::.. 
Zfish   295 SFLPGVPQIIAGFRDHDGIVVSVETFQTSKISQMIKNEYNCWKPTVCMNFCSDFLTFVKSIVKE- 358

  Fly   325 DCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTP 375
            |.|..||||.:|..: .|:|...|. :.:||:.||:       ..||...|
Zfish   359 DDPRLVYLFSWDPRR-DVTYTVHRD-STHTFIPDWY-------IKDMTSRP 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 10/27 (37%)
dxoXP_021330453.1 RAI1 249..316 CDD:312244 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167472527
eggNOG 1 0.900 E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1034620at2759
OrthoFinder 1 1.000 FOG0002356
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.