DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cuff and Y47H10A.3

DIOPT Version :10

Sequence 1:NP_610709.1 Gene:cuff / 36269 FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_493054.2 Gene:Y47H10A.3 / 190008 WormBaseID:WBGene00012959 Length:333 Species:Caenorhabditis elegans


Alignment Length:166 Identity:28/166 - (16%)
Similarity:51/166 - (30%) Gaps:53/166 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 VFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWV------DLQIRP------------------- 240
            :|::..||  ::|......|..||...|......      :.|:.|                   
 Worm   100 IFAYQRNG--IIFILKYTEEQTSTINKGGVFEHFCTKTRDEEQLEPDETVRKAVFTAEIPRGNGD 162

  Fly   241 ----MFMSRLDW--PEHNRTEALKWWVKCFLLGIESLYIARRD----ENAHVHNIEKTLVRDLWK 295
                |:..::|.  .|.||..   :.:|.|..|:...:..:|.    ..|...|:...::.....
 Worm   163 TFKVMYSGQIDAIDDEENRQH---YELKVFSGGLNEYFWKKRSLQTYWQAFFGNVPVLIIGSRTG 224

  Fly   296 SCEKD--------WSPTVCANFMIYLLNCISQVMAP 323
            ..|:|        |.|     |.:|.:..:.:...|
 Worm   225 LYERDPKTMPPNSWPP-----FSVYYVQKLKRDRIP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 DUF6454 <32..>69 CDD:437887
RAI1 <257..284 CDD:462550 5/30 (17%)
Y47H10A.3NP_493054.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.