DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and Y47H10A.3

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_493054.2 Gene:Y47H10A.3 WormBaseID:WBGene00012959 Length:333 Species:Caenorhabditis elegans

Alignment Length:166 Identity:28/167 (17%)
Similarity:51/167 (31%) Gaps:53/167 (32%)


  Fly   201 VFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWV------DLQIRP------------------- 240
            :|::..||  ::|......|..||...|......      :.|:.|                   
 Worm   100 IFAYQRNG--IIFILKYTEEQTSTINKGGVFEHFCTKTRDEEQLEPDETVRKAVFTAEIPRGNGD 162

  Fly   241 ----MFMSRLDW--PEHNRTEALKWWVKCFLLGIESLYIARRD----ENAHVHNIEKTLVRDLWK 295
                |:..::|.  .|.||..   :.:|.|..|:...:..:|.    ..|...|:...::.....
 Worm   163 TFKVMYSGQIDAIDDEENRQH---YELKVFSGGLNEYFWKKRSLQTYWQAFFGNVPVLIIGSRTG 224

  Fly   296 SCEKD--------WSPTVCANFMIYLLNCISQVMAP 323
            ..|:|        |.|     |.:|.:..:.:...|
 Worm   225 LYERDPKTMPPNSWPP-----FSVYYVQKLKRDRIP 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 5/31 (16%)
Y47H10A.3NP_493054.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167453005
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.