DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and M01G12.7

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_493060.1 Gene:M01G12.7 WormBaseID:WBGene00010821 Length:460 Species:Caenorhabditis elegans

Alignment Length:396 Identity:64/397 (16%)
Similarity:117/397 (29%) Gaps:178/397 (45%)


  Fly    43 FEPNSQKVPYVV-----------VPPSIKFPISLRYKDSPPKLEKKPNIFL-------------- 82
            :|.|..|..:|.           |||:          :|...:::|.||.:              
 Worm    75 YEGNCNKPDFVTNKNLLATIASFVPPT----------ESSGSVQQKENIQILVVRVGGVYYLAKL 129

  Fly    83 --DNMLQYIESSSYMY--VMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTM 143
              :|....:...|:::  ::.|..:.....||.:....|.::.:          .||...:...:
 Worm   130 SKENKKHRLFDCSFVFEHILTRATEDEMPMANGIVNKGVFKMEV----------PLGDGTFCTVL 184

  Fly   144 YICRIDVEQPDPIDQDN---LKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHGVFSFD 205
            |...:|...    |::|   ||               :||.|:..|...:.| :.:.:...||..
 Worm   185 YTGELDAVD----DRNNHVELK---------------LFEGGLTEHVWKRRS-QWMFWQSFFSNV 229

  Fly   206 LN---GNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEH--------NRTEALKW 259
            |.   |:|   :.|.|.|:..                    ::.|||.:        :|.|.|: 
 Worm   230 LTLIIGSR---NHPSLLEITD--------------------AKFDWPTNVLYDIETRSREEILE- 270

  Fly   260 WVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPI 324
                        .:|:|.|....|    ..:.|..|..:         :|...:.|.:.:   ..
 Worm   271 ------------EVAKRFEGTEDH----WTIEDGQKRLQ---------SFFNLIKNSVKK---DR 307

  Fly   325 DCPSTVYLFQFDASQ-------------------------------GTVSYKGLRGRNQYTFVSD 358
            ||    |:...|.||                               |.:||..:|        .:
 Worm   308 DC----YVITNDGSQWKIEQDHQKLAGTFRHVVEHILKSKGKMDINGNISYLPVR--------EE 360

  Fly   359 WFRMML 364
            |.|.::
 Worm   361 WERSLI 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 5/27 (19%)
M01G12.7NP_493060.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167453077
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.