DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cuff and F07H5.10

Sequence 1:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_495876.1 Gene:F07H5.10 WormBaseID:WBGene00008561 Length:334 Species:Caenorhabditis elegans

Alignment Length:302 Identity:57/303 (19%)
Similarity:99/303 (33%) Gaps:106/303 (35%)


  Fly    67 YKDSPPK-LEKKPNIFLDNMLQY------IESSSYMYVMVRNNQQAQLNANIVCTSEVLE----- 119
            |.:.||. :..||.|.|:  ::|      :..:.....|:..|...|.|.||    .|||     
 Worm     8 YDNRPPTGVRAKPVINLN--IEYTSCNDSVAPACSTRPMLIENMINQRNVNI----NVLEGYDPK 66

  Fly   120 ---------LMMCAPYEKKTGWSLGVTRYRNTMY-------------ICRID--VEQPDPID--- 157
                     :.....:|.||.:...:.|.|.:.:             :|.||  :::..|::   
 Worm    67 SKSVINQHSIYHLYEFESKTRFLDRIPRPRVSRFTELKTRFLCCRYVLCAIDDVMQKQKPMELMA 131

  Fly   158 -----------------QDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFH------ 199
                             |.:.|.....|...|.......|:..|:.:.:.|..:.||..      
 Worm   132 IRLNGDIYIGANKSMDLQTDKKTQEAAFGGLNFAMKVTRESDQKILKKHHSVVKQLRIENTRNSM 196

  Fly   200 --GVF------SFDLNGNRV---LFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNR 253
              .:|      :||..||.|   ...|.|:.::.:                   :|||       
 Worm   197 SMSIFVSSVARAFDQRGNVVELKTVGSKVMGKVQN-------------------LSRL------- 235

  Fly   254 TEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWK 295
             :|..||::..|.|.:.:....|.:|..|:.|.:..:.|..|
 Worm   236 -KARDWWLRALLSGADRIVYGLRMDNMKVNEIHEAQLTDFTK 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 7/27 (26%)
F07H5.10NP_495876.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167453056
eggNOG 1 0.900 E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.