DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and MDN1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_013207.1 Gene:MDN1 SGDID:S000004096 Length:4910 Species:Saccharomyces cerevisiae

Alignment Length:5893 Identity:1597/5894 (27%)
Similarity:2539/5894 (43%) Gaps:1397/5894 (24%)


  Fly    33 QKFIKKQKYVPQD-VERLF-----RSLSEQLPLPAYTVPIAASFEEQLLL----LLSMALRWDSA 87
            |:.|......|.| :|..|     .|.||.|...|.|:..:.|....:.|    .|.:..||...
Yeast    15 QRLILFNSAFPSDAIEAPFHFSNKESTSENLDNLAGTILHSRSITGHVFLYKHIFLEIVARWIKD 79

  Fly    88 SQRFHTYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEKQQSNGSLPSKKSKNGNHAADNLDD 152
            |:: ..|.|....|:.::.....|....:.|...:...|.....|   ||.:.           |
Yeast    80 SKK-KDYVLVIEKLASIITIFPVAMPLIEDYLDKENDHFITILQN---PSTQK-----------D 129

  Fly   153 LELIKCCFQLLKSDTPYFRELWDWSSFIATYTHNSSSPKTQLYCNYI--------VAMLTNMSAP 209
            .::    |::|.:   |:|.|:          ||.     :::..:|        |.:||.....
Yeast   130 SDM----FKILLA---YYRLLY----------HNK-----EVFARFIQPDILYQLVDLLTKEQEN 172

  Fly   210 QL-----------------NSLNEKIST--KTR------LEFDQEREQAW---NTARNTLCS--- 243
            |:                 .:||:.:.|  |:|      .|.|...:.::   |.|:.  |:   
Yeast   173 QVVIFLALKVLSLYLDMGEKTLNDMLDTYIKSRDSLLGHFEGDSGIDYSFLELNEAKR--CANFS 235

  Fly   244 --------YTPDASDQLLNLHLHGINKSVTNIEGVLLP---TFNEENLEFYASTDGCYDRIVKVD 297
                    :|.:.......:....::..|.:|.||::|   |.:::  .||..|      .|...
Yeast   236 KLPSVPECFTIEKKSSYFIIEPQDLSTKVASICGVIVPKVHTIHDK--VFYPLT------FVPTH 292

  Fly   298 STVVNLRSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIESREKALKKAEEEEQ 362
            .||.:||.:...:..:.||.|.|..|.|||.||..|::..|  |                     
Yeast   293 KTVSSLRQLGRKIQNSTPIMLIGKAGSGKTFLINELSKYMG--C--------------------- 334

  Fly   363 LLTPKKKAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFV 427
                                             ....::|.||:|||:|:|:|.|...|.||.|.
Yeast   335 ---------------------------------HDSIVKIHLGEQTDAKLLIGTYTSGDKPGTFE 366

  Fly   428 WLPGVLTQAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTN 492
            |..|||..||..|.|:|:||:|.|..|..:||.||||::.|::|...::||...||||..|||.|
Yeast   367 WRAGVLATAVKEGRWVLIEDIDKAPTDVLSILLSLLEKRELTIPSRGETVKAANGFQLISTVRIN 431

  Fly   493 KSASNSSQKSLYSLLDKYLYTINILPL---SRNELCKMVSINYPKLSTVANRIVD---------- 544
            :.....|...:|:|....:...|::.|   |..:|..:::..:|.|:.:..:::|          
Yeast   432 EDHQKDSSNKIYNLNMIGMRIWNVIELEEPSEEDLTHILAQKFPILTNLIPKLIDSYKNVKSIYM 496

  Fly   545 --VFLTFSSGNHTSADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHR- 606
              .|::.:.|.||                                     |:||.|||:|||.| 
Yeast   497 NTKFISLNKGAHT-------------------------------------RVVSVRDLIKLCERL 524

  Fly   607 ---------SNPQFSVTSSECAY-FVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHF 661
                     :.|...:.||  .| .:|..|.|.|...:.:.|....:|.:||..|.|..||...|
Yeast   525 DILFKNNGINKPDQLIQSS--VYDSIFSEAADCFAGAIGEFKALEPIIQAIGESLDIASSRISLF 587

  Fly   662 ANEYKPDVEFGLEHIKIGRASLLAKSDLNNSENEDISEQDLKRQKLSQQTRRAIGKVSNKRTTFS 726
            ..::.|.:|...:.||||||.||                   ::||:      |.|.|...|.|:
Yeast   588 LTQHVPTLENLDDSIKIGRAVLL-------------------KEKLN------IQKKSMNSTLFA 627

  Fly   727 FTRLASCILERIAVCVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGF 791
            ||..:..::|:|:||:..:||||||||||.|||:.||.||:....||.|:|::.|::..||:||:
Yeast   628 FTNHSLRLMEQISVCIQMTEPVLLVGETGTGKTTVVQQLAKMLAKKLTVINVSQQTETGDLLGGY 692

  Fly   792 KPVELNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIR----------TMINI 846
            |||....|..|::..||.|...||:.:||.:|.::....:|..:...:::          :::.|
Yeast   693 KPVNSKTVAVPIQENFETLFNATFSLKKNEKFHKMLHRCFNKNQWKNVVKLWNEAYKMAQSILKI 757

  Fly   847 CLQVAKNPELKANK----------LLPRWQTLREKLQKLQMQLDKSINISFA--FIPGSLVNCIS 899
            .....:|...|..|          ||.:|....:.::|.:.| ..||..||.  |:.||||..|.
Yeast   758 TNTENENENAKKKKRRLNTHEKKLLLDKWADFNDSVKKFEAQ-SSSIENSFVFNFVEGSLVKTIR 821

  Fly   900 NGDWVLLDEINLASAETLECLSTIL-EPEG-SVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKK 962
            .|:|:||||:|||:|:|||.:|.:| ||:. |::|.|:||..|:|.||||||||||||.||:||:
Yeast   822 AGEWLLLDEVNLATADTLESISDLLTEPDSRSILLSEKGDAEPIKAHPDFRIFACMNPATDVGKR 886

  Fly   963 DLPVGIRNRFTEFFVDELTTD-ADLSLLVSDYLANTGIQRKSVHN-IVQLYKSLRKLSELQ-LND 1024
            |||:|||:||||.:|.....| .||..::..|:....:..:.|.| |.:||...:|||:.. :.|
Yeast   887 DLPMGIRSRFTEIYVHSPERDITDLLSIIDKYIGKYSVSDEWVGNDIAELYLEAKKLSDNNTIVD 951

  Fly  1025 GLGNRPVYSLRTLCRSLRICAR--NLCGSIERNLYESFCLSFLTQLDPNSHHVVLLLIQN---AL 1084
            |...:|.:|:|||.|:|.....  ::.| :.|:||:.||:||||.||..|..::..:|:.   ..
Yeast   952 GSNQKPHFSIRTLTRTLLYVTDIIHIYG-LRRSLYDGFCMSFLTLLDQKSEAILKPVIEKFTLGR 1015

  Fly  1085 LSNVKAILSKQLPQLGENYLDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLARIISIGKLPIL 1149
            |.|||:|:|:..|..|.:|:.|:.||::.|....|...|||:|..|:||:.:|.|..|..:.|:|
Yeast  1016 LKNVKSIMSQTPPSPGPDYVQFKHYWMKKGPNTIQEQAHYIITPFVEKNMMNLVRATSGKRFPVL 1080

  Fly  1150 LQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFREGVLVQAMRHGF 1214
            :|||||:||||:|.|:|..:|::.:|||||||||||||:|||..|..|||:|:|||||:|:|.|:
Yeast  1081 IQGPTSSGKTSMIKYLADITGHKFVRINNHEHTDLQEYLGTYVTDDTGKLSFKEGVLVEALRKGY 1145

  Fly  1215 WIILDELNLASTDILEALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGLYGGRKTLSRAF 1279
            ||:|||||||.||:||||||:|||||||:|.|||.:|..||:|:|||||||||:|||||.|||||
Yeast  1146 WIVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVVHPHPDFLLFATQNPPGIYGGRKILSRAF 1210

  Fly  1280 KNRFIELHFADIPREELETILEKRCFIPPTYARKMVQCMTQLQQHRKNT----SKQVF-TLRDLF 1339
            :|||:||||.|||::|||.||.:||.|.|:||:|:|:...||...|..:    .|..| ||||||
Yeast  1211 RNRFLELHFDDIPQDELEIILRERCQIAPSYAKKIVEVYRQLSIERSASRLFEQKNSFATLRDLF 1275

  Fly  1340 RWGNRYTHADKSLHDDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFD 1404
            ||         :|.|...|   :.|...||::|:.:.|:.:|...::|||....:.|||:...: 
Yeast  1276 RW---------ALRDAVGY---EQLAASGYMLLAERCRTPQEKVTVKKTLEKVMKVKLDMDQYY- 1327

  Fly  1405 IQTDRESSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVC 1469
                    :.:..|.|:||      ..:.||:.|.|::|:.:..|:..|||||||.|||||||:|
Yeast  1328 --------ASLEDKSLEAI------GSVTWTKGMRRLSVLVSSCLKNKEPVLLVGETGCGKTTIC 1378

  Fly  1470 QLLASIADVQLRILNCHMHTEGADFLGGLRPCRGKESTQ-------------------------- 1508
            ||||.....:|..||.|.:||..|.||..||.|.:...|                          
Yeast  1379 QLLAQFMGRELITLNAHQNTETGDILGAQRPVRNRSEIQYKLIKSLKTALNIANDQDVDLKELLQ 1443

  Fly  1509 ---------------------------LFEWADGPLIYAMQEGSYFMADEISLAEDSVLERLNCI 1546
                                       ||||:|||||.||:.|::|:.||||||:||||||||.:
Yeast  1444 LYSKSDNKNIAEDVQLEIQKLRDSLNVLFEWSDGPLIQAMRTGNFFLLDEISLADDSVLERLNSV 1508

  Fly  1547 LEPERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELSPALRNRFTEVWCLPS 1611
            |||||::||||:|       |.|.:|.|...|||.||||||||:|||||||||||||||:| :||
Yeast  1509 LEPERSLLLAEQG-------SSDSLVTASENFQFFATMNPGGDYGKKELSPALRNRFTEIW-VPS 1565

  Fly  1612 DNKEDLIEIAYNCMRRQKEHENQAINTHKVAEYLVDVVLHIRDTNDKF------------KFSVR 1664
              .||..::            |..::: ::.|.|.|:...|...::.|            ..|:|
Yeast  1566 --MEDFNDV------------NMIVSS-RLLEDLKDLANPIVKFSEWFGKKLGGGNATSGVISLR 1615

  Fly  1665 DILAWANYM------VSNAKLSFAEQAIFGLETIFLDAL----EMLPHESQEQVELLKSNIVKQA 1719
            |||||..::      :.|...:.    |.|...:|:|||    .....|::..::.|::..:.|.
Yeast  1616 DILAWVEFINKVFPKIQNKSTAL----IQGASMVFIDALGTNNTAYLAENENDLKSLRTECIIQL 1676

  Fly  1720 IKQA--SLILQEKFTLEELSEKRGTEVELNECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQN 1782
            :|..  .|.||:    .|.:|...|:.||....|.| |.|.|       :....|...||||..|
Yeast  1677 LKLCGDDLELQQ----IETNEIIVTQDELQVGMFKI-PRFPD-------AQSSSFNLTAPTTASN 1729

  Fly  1783 LFRLLSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLL 1847
            |.|::.|:.:.||:||||.|||||||::.::.:..|.::.||||.|.|||.||||.|.|.|    
Yeast  1730 LVRVVRAMQVHKPILLEGSPGVGKTSLITALANITGNKLTRINLSEQTDLVDLFGADAPGE---- 1790

  Fly  1848 ESNTAATERQIRS--FVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPEL 1910
                       ||  |:|.|.|.|.|:| |..|:||||:|||.|||||||||.||||||.|||||
Yeast  1791 -----------RSGEFLWHDAPFLRAMK-KGEWVLLDEMNLASQSVLEGLNACLDHRGEAYIPEL 1843

  Fly  1911 NKSFHLAGSTRIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLN 1975
            :.||....:..:||.|||..|||||||||:||:|||:.|::..|:::|||.:....|        
Yeast  1844 DISFSCHPNFLVFAAQNPQYQGGGRKGLPKSFVNRFSVVFIDMLTSDDLLLIAKHLY-------- 1900

  Fly  1976 AYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGVASME-FGYKGGPYEFNL 2039
                                      .|...|:.|::::....|:..|...: :|..|.|:||||
Yeast  1901 --------------------------PSIEPDIIAKMIKLMSTLEDQVCKRKLWGNSGSPWEFNL 1939

  Fly  2040 RDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKS----YIRNV 2100
            ||.|||..||:.    |.:......|     ||       :.::..||.|...||:    .|.::
Yeast  1940 RDTLRWLKLLNQ----YSICEDVDVF-----DF-------VDIIVKQRFRTISDKNKAQLLIEDI 1988

  Fly  2101 F------STVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQADVLDLVNRQEQSPLL---- 2155
            |      ...|....:|: |::|:|||.                        |...:.|:.    
Yeast  1989 FGKFSTKENFFKLTEDYV-QINNEVALR------------------------NPHYRYPITQNLF 2028

  Fly  2156 -LDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALC-VLSNRL----CNTDIIDDSVTGSF 2214
             |:......:.:::.::...||:|.|.::||||:.|..|. :|..|:    .|:||....:.|.:
Yeast  2029 PLECNVAVYESVLKAINNNWPLVLVGPSNSGKTETIRFLASILGPRVDVFSMNSDIDSMDILGGY 2093

  Fly  2215 QQIDLNRHLEIIYKKVETLVFSCVQRAFVLHTQSEFVEQLWNNWSMYNKLAKVTTEAQQHSVLDE 2279
            :|:||.|.:..|.:::..:|...:                    ||..||:...|     ::::.
Yeast  2094 EQVDLTRQISYITEELTNIVREII--------------------SMNMKLSPNAT-----AIMEG 2133

  Fly  2280 LKLFSERLGSLGKIIEVLEATPQNCQ------------------VRALQQLAEIKSQLLLLQTYI 2326
            |.|....|.::        .||:..|                  ::.:....|..::::..:..:
Yeast  2134 LNLLKYLLNNI--------VTPEKFQDFRNRFNRFFSHLEGHPLLKTMSMNIEKMTEIITKEASV 2190

  Fly  2327 KTADSLNTGGSFEWVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQ 2391
            |          |||.|..:|.:::.|.:::|::.||||.:||||||.:.|.:|||||.|  .|.:
Yeast  2191 K----------FEWFDGMLVKAVEKGHWLILDNANLCSPSVLDRLNSLLEIDGSLLINE--CSQE 2243

  Fly  2392 DSAEVVYK-STNFRAFLTVDPKNGELSRAMRNRCVELSLSRDTYSVDDLRAFVHEQGVREMEAID 2455
            |....|.| ..|||.|||:|||.||||||||||.||:       .:|:|.               
Yeast  2244 DGQPRVLKPHPNFRLFLTMDPKYGELSRAMRNRGVEI-------YIDELH--------------- 2286

  Fly  2456 CILRVHKGLSQLTEFNNYSISHLTQFAFLSAAYRRIGYELKRAIYVAAME--VYVYSANTDLMGY 2518
                     |:.|.|:..:                :|:||...|...:::  :.....|...|..
Yeast  2287 ---------SRSTAFDRLT----------------LGFELGENIDFVSIDDGIKKIKLNEPDMSI 2326

  Fly  2519 GLSYYQNKL--REVVLAQT---------EVFEE--VAVIQEDFLSDVILNSGNLNSLTLIKRQAV 2570
            .|.:|....  |..:.||.         |..||  .|||....|.:|...:.|:.:.|       
Yeast  2327 PLKHYVPSYLSRPCIFAQVHDILLLSDEEPIEESLAAVIPISHLGEVGKWANNVLNCT------- 2384

  Fly  2571 ALKVLLDGYTEGKIPQKLLASLFHEMEKLKLDQRNPQKLIRHFLYMLYESSAIGDLE-LRHLYLQ 2634
                   .|:|.||.::|..                      |:..|.:   :|.|| :.:|| :
Yeast  2385 -------EYSEKKIAERLYV----------------------FITFLTD---MGVLEKINNLY-K 2416

  Fly  2635 PWLSKDTAFQELSQNLYNCLQKRSNTDTGTLANLPWNRKLIPRLRDYSTAESNSE---------- 2689
            |   .:..||: :..|::   |:...:|   .:|..|..::|.:..||....:.|          
Yeast  2417 P---ANLKFQK-ALGLHD---KQLTEET---VSLTLNEYVLPTVSKYSDKIKSPESLYLLSSLRL 2471

  Fly  2690 -LNPLNLSALLLARLVVDIIPVSSVTTVQQMNALQYSQALCKKQVTEKYANHL-----LANFSSF 2748
             ||.||...|:..:        |:...:.::..::.|.|...       ..||     :..|...
Yeast  2472 LLNSLNALKLINEK--------STHGKIDELTYIELSAAAFN-------GRHLKNIPRIPIFCIL 2521

  Fly  2749 LEVLHTSLLEDLETADL--DLPQYAHLVTRFHW-FNRILATAQQKLLYNNELHVPLMHKLVLHFQ 2810
            ..:| |.:.|:|:|..|  ...||     :::| ...|:..|.:..:..:|..:.:..:|:  ..
Yeast  2522 YNIL-TVMSENLKTESLFCGSNQY-----QYYWDLLVIVIAALETAVTKDEARLRVYKELI--DS 2578

  Fly  2811 WLEKHLLVPLIELTAKSGCARMLTIQDRTLKIKKYIEETR-RPLNVTCKIYSKQF-TQFQPYYQD 2873
            |:........||:|.      .|.|   .|:....::.:| ..:.:...|:.|.: |....:...
Yeast  2579 WIASVKSKSDIEITP------FLNI---NLEFTDVLQLSRGHSITLLWDIFRKNYPTTSNSWLAF 2634

  Fly  2874 QQIQRHIELDDLEKLLSVVPSYGNLELSSWLKRWLLLQTDDANKWRSFLRKHTNGFQPKAFEISG 2938
            :::....|..|..:||....||.:::                                ...::..
Yeast  2635 EKLINLSEKFDKVRLLQFSESYNSIK--------------------------------DLMDVFR 2667

  Fly  2939 SLRNETLQSHLQKLQTTLKEAQENSAEIEMDLELDLNSIKTLLEAETEESESYIHPDGIPTNTPK 3003
            .|.::.|.:.|.:....|.:.::...|:|:.....||..|.....|.:....|.    ...:|.:
Yeast  2668 LLNDDVLNNKLSEFNLLLSKLEDGINELELISNKFLNKRKHYFADEFDNLIRYT----FSVDTAE 2728

  Fly  3004 LL--IAALRELFMERLLTGTLRDDFDEQVNPLYADQLLTLNSN---LWHCLKTLESANRTEITNA 3063
            |:  :|....|..::|                  .:|:|...|   ::..|.|.::|..|..|:.
Yeast  2729 LIKELAPASSLATQKL------------------TKLITNKYNYPPIFDVLWTEKNAKLTSFTST 2775

  Fly  3064 WIE---LKNEVNELQNYDEFAVLLEKIGGGYKGLRSYQRQYRNSVQCYQLENLSTRLDCVQGPSE 3125
            ...   |::.|.:..|...|:                ..|.:.|:...:| .||:.:.|  .|:.
Yeast  2776 IFSSQFLEDVVRKSNNLKSFS----------------GNQIKQSISDAEL-LLSSTIKC--SPNL 2821

  Fly  3126 EGSTDISSQF-CYRGPALSGVILSLICQPNGQLRSVPLSELLEWRSALQQTRHLIWENSQLLTSR 3189
                 :.||. .|:...||.:...:.....|....:.|.||.                       
Yeast  2822 -----LKSQMEYYKNMLLSWLRKVIDIHVGGDCLKLTLKELC----------------------- 2858

  Fly  3190 YSGEVNNLLQAKENARQLLKELEYV---RKLSEKEQKANQGFENCAKELEKMIEKLEKEENNNAS 3251
                  :|::.|..:...:...||:   ..|:|.           :|.||::.|         |.
Yeast  2859 ------SLIEEKTASETRVTFAEYIFPALDLAES-----------SKSLEELGE---------AW 2897

  Fly  3252 MTKDFEVSLTNALVGAIELCLLTNTPLIDPVEKNRLKNEYIAEDIDCLSTLTTAYDFMKIAMKYR 3316
            :|  |...|.        |..:.::| .||.     .::|:..|: .|.|.|.:.:.||.....|
Yeast  2898 IT--FGTGLL--------LLFVPDSP-YDPA-----IHDYVLYDL-FLKTKTFSQNLMKSWRNVR 2945

  Fly  3317 HF---GEEIYSELELRLRTALQRQQQLSQKLALRSEKCLYASLVQDITHFLHSNGDCESLYKLFQ 3378
            ..   .|||::|                             .|:..|     |:.|.....::::
Yeast  2946 KVISGDEEIFTE-----------------------------KLINTI-----SDDDAPQSPRVYR 2976

  Fly  3379 L------IHSEWENFQGLHVATSAQLK--------SSIEVLGKLDLWLANAQRFVHHTLSRYSAY 3429
            .      :..||..|.. ...:|.|:|        :|.:...:|::...|:..|::...|.||. 
Yeast  2977 TGMSIDSLFDEWMAFLS-STMSSRQIKELVSSYKCNSDQSDRRLEMLQQNSAHFLNRLESGYSK- 3039

  Fly  3430 YQDFVEPIKCSVNQLRFGLESLKVIFTRVQQAGSVSQAEQMQQTIGDIVQFPSQHPLVIRNSRLY 3494
            :.|..:.:...:..:.||.:.||:..::.:.:..:|....|.             |:.|.     
Yeast  3040 FADLNDILAGYIYSINFGFDLLKLQKSKDRASFQISPLWSMD-------------PINIS----- 3086

  Fly  3495 GLLAELPHSEYEYFRLLKAKLSELSNYIALG--------RVI------------DETTFAAYDDA 3539
              .||...|.|.          |||.:...|        :|:            |......::.|
Yeast  3087 --CAENVLSAYH----------ELSRFFKKGDMEDTSIEKVLMYFLTLFKFHKRDTNLLEIFEAA 3139

  Fly  3540 LSICNQTWQQEEHRRCQLKAEAESLYVTKTKGGVDSEELIEMQEIEHNFPTNLDEDFAEFVSQ-P 3603
            |......|.....|:.|.:.|..:::                     .|..|.|:..|:|... |
Yeast  3140 LYTLYSRWSVRRFRQEQEENEKSNMF---------------------KFNDNSDDYEADFRKLFP 3183

  Fly  3604 TLEQVLKLDKKASAKDKQSQIVVEEDYAFLARNFIDVMTRHTQVYYKEQPKSSKELELHLLAPYQ 3668
            ..|....:   .:.||..|...:::.|..||..:|.|..:.....:..:.||...:         
Yeast  3184 DYEDTALV---TNEKDISSPENLDDIYFKLADTYISVFDKDHDANFSSELKSGAII--------- 3236

  Fly  3669 ARFQVFANLHGHYKTALGSSLEERACNGLAFGLALQQKQLRDIELEEGVSSSPY---DFYKDSNI 3730
                         .|.|...|:......|..|.........|.|.:...::..:   |||.|.:|
Yeast  3237 -------------TTILSEDLKNTRIEELKSGSLSAVINTLDAETQSFKNTEVFGNIDFYHDFSI 3288

  Fly  3731 SEIQSCLDVMERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLAL 3795
            .|.|...|::|.:.|.||:.|:|:||||.|.::..|.......|...|:.|.....:.:...||.
Yeast  3289 PEFQKAGDIIETVLKSVLKLLKQWPEHATLKELYRVSQEFLNYPIKTPLARQLQKIEQIYTYLAE 3353

  Fly  3796 WNEVAHRNNNLVSEEIEVAEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYN--LLQQFI 3858
            |.:.|....:|.:....:.:.:..|.:|||:.|:.......|:......::||::|.  ::..|:
Yeast  3354 WEKYASSEVSLNNTVKLITDLIVSWRKLELRTWKGLFNSEDAKTRKSIGKWWFYLYESIVISNFV 3418

  Fly  3859 HQKQLDHSYTDIKLAEQRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQ 3923
            .:|                        ::...:..|    :|..|..|...|..|:|:.||.|::
Yeast  3419 SEK------------------------KETAPNATL----LVSSLNLFFSKSTLGEFNARLDLVK 3455

  Fly  3924 GFELYLHNVE-RAGKINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYS 3987
            .|..::..:. |:.||.||      |||...::.||...|.:.....:..:||::.:.:.:.|: 
Yeast  3456 AFYKHIQLIGLRSSKIAGL------LHNTIKFYYQFKPLIDERITNGKKSLEKEIDDIILLASW- 3513

  Fly  3988 KDLSYFSMRNSVASVHRNLNKFLKEYRLSIQEKISEVFQPKDSTAKDYTFGTDKGKGLRNYNKIK 4052
            ||::..:::.|....|.||.|.:::||              |....|.....:.|....|.||:|
Yeast  3514 KDVNVDALKQSSRKSHNNLYKIVRKYR--------------DLLNGDAKTIIEAGLLYSNENKLK 3564

  Fly  4053 YLHTERQQFV------ASEKLLEKFAI----QEEFLSDNTLLQRLDKHFRTARHVVKETLGQVPY 4107
             |.|.:|.|.      ||:.|:::.:.    .....:.:|:...:|.:..      |.:..:.| 
Yeast  3565 -LPTLKQHFYEDPNLEASKNLVKEISTWSMRAAPLRNIDTVASNMDSYLE------KISSQEFP- 3621

  Fly  4108 GELITELDDLLASQLERCEHLRSLNVDRSKERP-----QQKQEAKQILQQKRKALTDLFKMLHRL 4167
                 ...||.:......|.||       ||.|     :.|:....:..||.|.|.|..|.|.|:
Yeast  3622 -----NFADLASDFYAEAERLR-------KETPNVYTKENKKRLAYLKTQKSKLLGDALKELRRI 3674

  Fly  4168 GANYKTGLLELSLRNEFEDFQLPPYSIRSMLPRLHPTAQQLDEHLDLYYMKSVFKLKLLQNIMLT 4232
            |       |:::.|   ||.|....|..::|..:.|...:.....|.::.|.:..|..|::....
Yeast  3675 G-------LKVNFR---EDIQKVQSSTTTILANIAPFNNEYLNSSDAFFFKILDLLPKLRSAASN 3729

  Fly  4233 PLSELGPPNIERIKGFAVDLFLLVQQQREHLSGSTKELHELRNSLDSLRKLAEIIPQADINPSTL 4297
            |..::....|||....|..|...:...|..||..|.:..::...:..|.....:  :.||..|:|
Yeast  3730 PSDDIPVAAIERGMALAQSLMFSLITVRHPLSEFTNDYCKINGMMLDLEHFTCL--KGDIVHSSL 3792

  Fly  4298 NFVKSADIAMEIKQHLRQIHYVLKQWKLLLSCAPSSFIEESENRLLVRKISLAQSELHSLCIQIL 4362
                        |.::..:. :.::|      .||.....::...::.|.| |.||...:.:...
Yeast  3793 ------------KANVDNVR-LFEKW------LPSLLDYAAQTLSVISKYS-ATSEQQKILLDAK 3837

  Fly  4363 NSSQELLNELNNANLEYLSSEKCVTYQKSYAEIQENIKKTLELLRTGQNDYLPLAQPIVELLDSV 4427
            ::........|::.:  ..|....:|.:....|.|.:||......||......:   |:|.:.:.
Yeast  3838 STLSSFFVHFNSSRI--FDSSFIESYSRFELFINELLKKLENAKETGNAFVFDI---IIEWIKAN 3897

  Fly  4428 Q---LKNHTEIAPEAIDLANADTELANIAHSVLMSMQKIYKHHVKTDEVNQNGEAKEQDEESKEA 4489
            :   :|...:..|...|:..|   ......|:::|.||:.            |:..|...|:.:.
Yeast  3898 KGGPIKKEQKRGPSVEDVEQA---FRRTFTSIILSFQKVI------------GDGIESISETDDN 3947

  Fly  4490 LQEQHLKKCLTGELTSDWQQLSLPRVLGK-LSNVLLVLKHSHFEGKDKLLCVRRAIGL-LPVLEQ 4552
            ......||.:..      .:|....|:.| :...|.:||...|...:.:. |:..|.. |||:.:
Yeast  3948 WLSASFKKVMVN------VKLLRSSVVSKNIETALSLLKDFDFTTTESIY-VKSVISFTLPVITR 4005

  Fly  4553 YQLLADYLLLQQLATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKNGEGFGLE 4617
            |......:|.:....:..:::.:.|:.|:...:...|||.|....::.:.::.|     ||.||.
Yeast  4006 YYNAMTVVLERSRIYYTNTSRGMYILSTILHSLAKNGFCSPQPPSEEVDDKNLQ-----EGTGLG 4065

  Fly  4618 DGTG-ENDASDKIESEDQLDDAKRPEDRKDEGDKQEPDCK-EEKGIEMSDDFDAKMQDVEKPEE- 4679
            ||.| :|:..|..:.||..:||:  .:.|::.||.|.|.: |:..:||..|...:::|:...|| 
Yeast  4066 DGEGAQNNNKDVEQDEDLTEDAQ--NENKEQQDKDERDDENEDDAVEMEGDMAGELEDLSNGEEN 4128

  Fly  4680 DDSGESEEEEDLNKEMGE-TEEGAEKLDDQIWGDDEEEKPEEEQEPDMN------EEDQGKGSKD 4737
            ||.....|||:|::|:.: .|:....:||::| ||:.....:|::.|.|      |||......|
Yeast  4129 DDEDTDSEEEELDEEIDDLNEDDPNAIDDKMW-DDKASDNSKEKDTDQNLDGKNQEEDVQAAEND 4192

  Fly  4738 EKDAHNDLDTKNDA-AKEDGKDEHEKDGLDATNEPSGEDKRKEQAKDIDDMKDPEMDEEQTNAMH 4801
            |:...|......|. |.|||.:|.|            .|:..|:..|:.:.:|...|||..:...
Yeast  4193 EQQRDNKEGGDEDPNAPEDGDEEIE------------NDENAEEENDVGEQEDEVKDEEGEDLEA 4245

  Fly  4802 NELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEE 4866
            |    .||.|.:||.:..|:|..|::.||        |:| |.:.|......|..|:::.:..:|
Yeast  4246 N----VPEIETLDLPEDMNLDSEHEESDE--------DVD-MSDGMPDDLNKEEVGNEDEEVKQE 4297

  Fly  4867 GDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAE---TQKRGELEDEDDSKPEDSPE 4928
            ...:   ||:|.||.|     .|||.||.|.|..|:|..|.:   |...|: |||::...|.:..
Yeast  4298 SGIE---SDNENDEPG-----PEEDAGETETALDEEEGAEEDVDMTNDEGK-EDEENGPEEQAMS 4353

  Fly  4929 DSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQD-PDIKQDQKLDEQET 4992
            |.:|.|::...|      ::|:|.. |:|.:.:         |.|::..| .||.|:..: :|::
Yeast  4354 DEEELKQDAAME------ENKEKGG-EQNTEGL---------DGVEEKADTEDIDQEAAV-QQDS 4401

  Fly  4993 GEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQTQEKRKQGRTNEERSLGEAEQNKLKQ 5057
            |.:  |.|....|..:....|.:.|.:...:||:::..:..|:.::..|...:.||::.:...::
Yeast  4402 GSK--GAGADATDTQEQDDVGGSGTTQNTYEEDQEDVTKNNEESREEATAALKQLGDSMKEYHRR 4464

  Fly  5058 LKTIDQLKDSKESDDAEQEKPEPMDQTEAEEYQHVKEPKNSDKTT--LDNATEEQSKKIQHQEDE 5120
            .:.|.:.:.:.|.|:..::..|..|     |::|| |..|::..|  |.:||::|.:.|......
Yeast  4465 RQDIKEAQTNGEEDENLEKNNERPD-----EFEHV-EGANTETDTQALGSATQDQLQTIDEDMAI 4523

  Fly  5121 PPNEEEIEAENVDELMEAEEPAVDPEDDAELEQLGAEKTEQKSDKPSK------TEKSKEQLETP 5179
            ..:.||.|.:..:.:.:|::..:|.:::..|..:.|.  :..:|..||      ..||:|     
Yeast  4524 DDDREEQEVDQKELVEDADDEKMDIDEEEMLSDIDAH--DANNDVDSKKSGFIGKRKSEE----- 4581

  Fly  5180 EGMEIEGEVVLTMTVPRSSETTAHSNSEILLDKSSHAEDLSSAEQIELRQQYQKQLTTFRVAQPE 5244
               :.|.|:               ||.....|:...:|..|..|.||..........|     ||
Yeast  4582 ---DFENEL---------------SNEHFSADQEDDSEIQSLIENIEDNPPDASASLT-----PE 4623

  Fly  5245 ---HEDYETWQGISNRMTQNARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRK 5306
               .|..|.|.............|.||||||||||..|:|||||:||:|:|||:|||||||||||
Yeast  4624 RSLEESRELWHKSEISTADLVSRLGEQLRLILEPTLATKLKGDYKTGKRLNMKRIIPYIASQFRK 4688

  Fly  5307 DKIWLRRTKPAQRDYKITIAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQ 5371
            ||||||||||::|.|:|.||:||||||..:....|..:::.|||:.||.||:|.||||.|||..:
Yeast  4689 DKIWLRRTKPSKRQYQIMIALDDSKSMSESKCVKLAFDSLCLVSKTLTQLEAGGLSIVKFGENIK 4753

  Fly  5372 IILNHTEQF---DGPRLVNALNFAQDKTKIAGLLNFIRTANAEESGTGGDNGLFE---------- 5423
            .:.:..:||   .|.|......|.:.||.:..|:       ||.:      .:||          
Yeast  4754 EVHSFDQQFSNESGARAFQWFGFQETKTDVKKLV-------AEST------KIFERARAMVHNDQ 4805

  Fly  5424 -NLLLILSDGRNIFSEGAQNVKNAIKLARLQRIFLVYIIIDNPDNKNSILDIQHVAVNAD----G 5483
             .|.:::|||   ..|..:.::..::.||..:|.||::|||...:..||||:..|....|    .
Yeast  4806 WQLEIVISDG---ICEDHETIQKLVRRARENKIMLVFVIIDGITSNESILDMSQVNYIPDQYGNP 4867

  Fly  5484 SVNINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWF-ELVNS 5525
            .:.|..|||:|||.:||:|.|:::||.:||..:||:| :|.:|
Yeast  4868 QLKITKYLDTFPFEFYVVVHDISELPEMLSLILRQYFTDLASS 4910

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1534/5563 (28%)
P-loop_NTPase 315..505 CDD:304359 61/190 (32%)
P-loop_NTPase <887..972 CDD:304359 54/89 (61%)
P-loop_NTPase 1147..1283 CDD:304359 97/136 (71%)
P-loop_NTPase 1454..1603 CDD:304359 95/202 (47%)
P-loop_NTPase 1795..1946 CDD:304359 86/153 (56%)
P-loop_NTPase <2335..>2378 CDD:304359 18/43 (42%)
Prothymosin 4843..4920 CDD:281265 26/80 (33%)
PHA03151 4856..5060 CDD:177546 51/208 (25%)
MttA_Hcf106 <5046..5166 CDD:294511 26/122 (21%)
vWA_midasin 5261..5526 CDD:238737 122/285 (43%)
MDN1NP_013207.1 MDN1 89..4910 CDD:227596 1576/5817 (27%)
P-loop_NTPase 310..427 CDD:304359 55/173 (32%)
P-loop_NTPase 648..>703 CDD:304359 29/55 (53%)
P-loop_NTPase 1078..1214 CDD:304359 97/136 (71%)
P-loop_NTPase 1363..1558 CDD:304359 95/202 (47%)
P-loop_NTPase 1742..1879 CDD:304359 86/153 (56%)
P-loop_NTPase <2191..2276 CDD:304359 47/97 (48%)
ASF1_hist_chap <4167..4315 CDD:304562 50/181 (28%)
ASF1_hist_chap <4263..4447 CDD:304562 56/221 (25%)
vWA_midasin 4643..4910 CDD:238737 121/283 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354849305
eggNOG 1 0.900 E1_COG5271
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1604 1.000 Inparanoid score I8
Isobase 1 0.950 0 Normalized mean entropy S5686
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 1 1.000 T1135548
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R702
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.