DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and AT1G67120

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001322748.1 Gene:AT1G67120 AraportID:AT1G67120 Length:5400 Species:Arabidopsis thaliana

Alignment Length:6170 Identity:1637/6171 (27%)
Similarity:2601/6171 (42%) Gaps:1502/6171 (24%)


  Fly    45 DVERLFRSLSEQLPLPAYTVPI---------------------------AASFEEQLLLLLSMAL 82
            |.|.:..:|.:....|.:|||:                           :..:.:.:..:|..|:
plant    41 DNEEVIHALGDAFLHPEFTVPLVHCFLPIIRNVVDRVVGLLRLVDDLKSSIDYSDDVSSVLDNAM 105

  Fly    83 R--------WDSASQRFHTYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEKQQSNGSLPSKK 139
            .        :....||...::..|:|.|:.::|:........:||...|.|:|:......:    
plant   106 TEGISVIDFYVRRGQRLELHECACLAFSRALHFNTSLLGSILNYFEKAPPPYERILVKDIV---- 166

  Fly   140 SKNGNHAADNLDDLELIKCCFQLLKSDTPYFRELWDWSSFIATYTHNSSSPKTQ----------L 194
            |::...|.|..  |..::..::.|......|.:|||||.::.:....|..|:.|          :
plant   167 SESRMEATDAY--LLCLRVSYRFLVIRPEVFSKLWDWSCYLDSMKRLSECPRQQRHFLEKYRDAV 229

  Fly   195 YCNYIVAMLTNMSAPQLNSL-----NEKISTKTRL-EFDQEREQAWNTARNTLCSYTPDASDQLL 253
            :|...:..:....:.:|...     .|.:|...|. ||.|:.|.........|.:||...|.|..
plant   230 WCGIQILSVVLRCSDRLAGCFGFEEEEALSCLLRWEEFCQDIEIEKAGLYIQLPTYTALKSLQQF 294

  Fly   254 NLHLHGINKSVTNIEGVLLPTFNEENLEFYASTDGCYDRIVKVDSTVVN---------------L 303
            |..:.||||.            ....||    .|....:|.::|:..||               .
plant   295 NTLVPGINKR------------QSAGLE----ADEPQMKIRRLDTWDVNSFSEPFEIHSRVKKSF 343

  Fly   304 RSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIESREKALKKAEEEEQLLTPKK 368
            ..::|.|:..:|:.|.||.|.||:.||..||.::|      |.:                     
plant   344 EMVSLAVSQKRPVLLYGPSGSGKSALIRKLADESG------NHV--------------------- 381

  Fly   369 KAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVL 433
                                           :.|.:.||.|.|.|:|.|.|||.||||.|.||.|
plant   382 -------------------------------VFIHMDDQLDGKTLVGTYVCTDQPGEFRWQPGSL 415

  Fly   434 TQAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTN------ 492
            |||:|:|:|::|||:|.|..|...:|||||...|..:....:.::|...||||.|:.|.      
plant   416 TQAIMNGFWVVLEDIDKAPSDVPLVLSSLLGGSCSFLTSQGEEIRIAETFQLFSTISTPECSVSH 480

  Fly   493 -KSASNSSQKSLYSLLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSSGNHTS 556
             :.|.||        |......|.:.|..|..|..::...||.|..||.::::.|.|.:|.    
plant   481 IRDAGNS--------LSPLWRRIVVYPPDRESLQSILGARYPNLGPVAEKLIETFETINSA---- 533

  Fly   557 ADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSN--PQFSVTSSECA 619
               ||.|.|....:|:..:           |||:.   .|.|||:|.|.|.:  |.:.      .
plant   534 ---LRPQFSSSTTENSATF-----------SSPSR---FSLRDLLKWCERVHGLPSYD------G 575

  Fly   620 YFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRASLL 684
            :.|:|.|.|:|.:.....|.:|. ::.|.|.:..:...    .::.||.::.....:||||.|| 
plant   576 HAVYQEAADIFSASNMSVKNRVA-VSEIVASIWNVAVP----ESQDKPPIQEFSGILKIGRVSL- 634

  Fly   685 AKSDLNNSENEDISEQDLKRQKLSQQTRRAIGK-VSNKRTTFSFTRLASCILERIAVCVTHSEPV 748
                                         .:|: .|:.|:.|..||.::.:||:||..|.::|||
plant   635 -----------------------------PLGETASHDRSRFVETRTSTRLLEKIARSVEYNEPV 670

  Fly   749 LLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVELNYVLAPLRNEFEYL--- 810
            |||||||.|||:.||.||.....||.|:|::.|||:.||:|||||::...:...:.|||..|   
plant   671 LLVGETGTGKTTLVQNLAHWIGQKLTVLNLSQQSDIVDLLGGFKPIDPKLMCTMVYNEFNELARD 735

  Fly   811 ------------LCETFNQEKNLQFL--------------------RLFATHYNSGRHAVIIRTM 843
                        |.:.|..:|...||                    ::......|||.       
plant   736 LKIKDDSKIMKWLQDNFRAKKWHTFLTGLLDIIKGIEGRITERMEGKIGEARSRSGRK------- 793

  Fly   844 INICLQVAKNPELKANKLLPRWQTLREKLQKLQMQLDKSINISFAFIPGSLVNCISNGDWVLLDE 908
                   .|.||    :.|.....||.|:.|::.|: .|..:.|.|:.|:.|..:..|.||||||
plant   794 -------RKKPE----EELKNCACLRTKVNKIRQQI-HSGGMVFTFVEGAFVTALREGHWVLLDE 846

  Fly   909 INLASAETLECLSTILE-PEGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNRF 972
            :|||..|.|..|..:|| ..||:.|.||||...:.||.:||:||||||.||.||:|||...|:||
plant   847 VNLAPPEILGRLIGVLEGVRGSLCLAERGDVMGIPRHLNFRLFACMNPATDAGKRDLPFSFRSRF 911

  Fly   973 TEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQLYKSLRKLSELQLNDGLGNRPVYSLRTL 1037
            ||:.||:...|.||.:.|..:|...|...|.|.|||..||..::|||..|.||...:|.||||:|
plant   912 TEYAVDDDICDDDLEIFVRRFLGGRGSDSKLVANIVWFYKEAKRLSEESLQDGANQKPQYSLRSL 976

  Fly  1038 CRSLRICAR-NLCGSIERNLYESFCLSFLTQLDPNSHHVVLLLIQNALLSNVKA-ILSKQLPQLG 1100
            .|:|....: ...|..::.||:.|.:.||:.||.:|..:|..:|:.....|::: .|.:.|.:|.
plant   977 YRALEYAIKAEAIGGFQKALYDGFSMFFLSLLDASSAKIVEPIIKRISGENIRSQPLQRYLGELK 1041

  Fly  1101 ENYLDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDYV 1165
            .:...|.|              .|:.|:||..:|..||..|.|.:.|:|||||||:|||||:.|:
plant  1042 GSSDKFVG--------------SYVKTKSVIDHLNHLAHAIFIKRYPVLLQGPTSSGKTSLVKYL 1092

  Fly  1166 ARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFREGVLVQAMRHGFWIILDELNLASTDILE 1230
            |..|||:.:||||||.||:|||:|:|..|..|||.|.||.||:|:|.|.||:|||||||.:|:||
plant  1093 AAISGNKFVRINNHEQTDIQEYLGSYMTDSSGKLVFHEGALVKAVRGGHWIVLDELNLAPSDVLE 1157

  Fly  1231 ALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPREE 1295
            ||||:|||||||::.|....:.||||||||||||||.||||||.|||||:|||:|:|..:||.:|
plant  1158 ALNRLLDDNRELFVPELSETISAHPNFMLFATQNPPTLYGGRKILSRAFRNRFVEIHVDEIPEDE 1222

  Fly  1296 LETILEKRCFIPPTYARKMVQCMTQLQQHRKNTSKQVF-------TLRDLFRWGNRYTHADKSLH 1353
            |..||..:|.|..::|.|||:.|..||::|:  |.:.|       |.||||||..|:...|.:.|
plant  1223 LSEILTTKCSIANSHASKMVEVMKDLQRNRQ--SSKAFAGKHGYITPRDLFRWAYRFRTYDGTSH 1285

  Fly  1354 DDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFDIQTDRESSSMVSRK 1418
            ::        |..|||.:|:.::|...|..::::.|..:||..|....|::::..|         
plant  1286 EE--------LAREGYYILAERLRDDTEKVVVQEVLERHFRVSLAKDDLYNMELPR--------- 1333

  Fly  1419 ILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRIL 1483
             ||:|:|.|    ..||::|.|:..:..::.:..|||||||.||.||||:||:|:.:...:|.||
plant  1334 -LDSIQNRK----FTWTQSMRRLFFLIDRSYKLREPVLLVGDTGGGKTTICQILSDVKKKRLHIL 1393

  Fly  1484 NCHMHTEGADFLGGLRPCRGK--------------ESTQ-------------------------- 1508
            |||.:||.:|||||..|.|.:              |.:|                          
plant  1394 NCHQYTETSDFLGGFFPVRDRSKLITEYENQVKQLELSQALTPFGQDIVICGDISRAEVSIKSVE 1458

  Fly  1509 ----------------------------------------LFEWADGPLIYAMQEGSYFMADEIS 1533
                                                    :|.|.||||:.||:.|:..:.||||
plant  1459 VALEKYKNGSVIGVAATPQDVDFLEKIRNNMVMLYQKWRAIFVWQDGPLVEAMRAGNIVLVDEIS 1523

  Fly  1534 LAEDSVLERLNCILEPERTVLLAEKGG--ISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELS 1596
            ||:||||||:|.:||.:|.:.||||||  :.|:.|..||.|        |||||||||:||||||
plant  1524 LADDSVLERMNSVLETDRKLSLAEKGGPVLEEVVAHEDFFV--------LATMNPGGDYGKKELS 1580

  Fly  1597 PALRNRFTEVWCLPSDNKEDLIEIAYNCMRRQKEHENQAINTHKVAEYLVDVVLHIRDTNDKF-- 1659
            |||||||||:|..|..:.|:|..||::.:...||..            :||.:::..:..::.  
plant  1581 PALRNRFTEIWVPPITDTEELRSIAFSGLSSLKESN------------VVDPIINFWEWFNRLHT 1633

  Fly  1660 --KFSVRDILAWANYM-VSNAKLSFAEQAIFGLETIFLDALEMLPHESQEQVELLKSNIVKQAIK 1721
              ..:|||:|:|..:: ::...|..|...:.|...:.||.|.:....|....:.|:.......::
plant  1634 GRTLTVRDLLSWVAFVNMATESLGPAYAILHGAFLVLLDGLSLGTGFSGRDGQDLREKCFAFLLQ 1698

  Fly  1722 QASLILQEKFTLE-------------ELSEKRGTEVELNECRFGIRPFFIDVNQERLTSAKEDFL 1773
            |..|...:...||             .:.||  ::...:|..|||.||||....|.......:||
plant  1699 QLELFASDTLPLELSRMELYGWGDSKAICEK--SKSVRHEGMFGIDPFFISKGDENPEIGGFEFL 1761

  Fly  1774 FDAPTTKQNLFRLLSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGT 1838
              ||||.:|:.|:|.|:.|.||:||||.|||||||::.::|...|:::|||||.|.||:.||.|:
plant  1762 --APTTHRNVLRVLRAMQLSKPILLEGSPGVGKTSLILALGKYSGHKVVRINLSEQTDMMDLLGS 1824

  Fly  1839 DLPAEDNLLESNTAATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRG 1903
            |||.|.:           :...|.|.||.||.||| :.:|:||||||||||||||||||:||||.
plant  1825 DLPVESD-----------EDMKFAWSDGILLQALK-EGSWVLLDELNLAPQSVLEGLNAILDHRA 1877

  Fly  1904 EVYIPELNKSFHLAGSTRIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVTEKYG 1968
            :|:||||..:|....:.|:||||||..|||||||||:||||||||||:.:|..:|.|.:....| 
plant  1878 QVFIPELGCTFECPPTFRVFACQNPSTQGGGRKGLPKSFLNRFTKVYVDELVEDDYLFICRSLY- 1941

  Fly  1969 KYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRG-VASMEFGYKG 2032
                                             .|....|.::|:..:.||..| :...:||:.|
plant  1942 ---------------------------------PSVPSPLLSKLIALNRQLHDGTMLYRKFGHDG 1973

  Fly  2033 GPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSYI 2097
            .|:||||||::|.|..:                |.|..|  |.:...:.::|.||||...|:..:
plant  1974 SPWEFNLRDVIRSCQFM----------------QEAIHD--LEVESFLNVLYIQRMRTATDRKEV 2020

  Fly  2098 RNVFSTVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQADV---LDLVNRQEQSPLLLDSQ 2159
            ..::..:|        ..:..:..|   .:|.||...|....|.:   |:..|...:...||...
plant  2021 LRIYKAIF--------DKTPSINPY---PRVQLNPAYLVVGTAAIKRNLNQSNIASEQLKLLPEI 2074

  Fly  2160 RQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLS----NRLCNTDIIDDS-VTGSFQQIDL 2219
            ||.|:.:...|..:...:|.|.:.||||.:|..|..|:    |.|..:...|.| :.|.|:|.:.
plant  2075 RQNLEAVAHCVQNKWLCILVGPSSSGKTSVIRILAQLTGYPLNELNLSSATDSSDLLGCFEQYNA 2139

  Fly  2220 NRHLEIIYKKVETLVFSCVQRAFVLHTQSEFV----EQLWNNWSMY-NKLAKVTTEAQQHSVLDE 2279
            .|:..::..:||.||..  ..:.:|.:..|.:    ..|.:.|..| ||:         .|.|.|
plant  2140 FRNFRLVMTRVEHLVDE--YNSLLLQSSQEALFSNRSGLVSRWLSYLNKI---------DSSLVE 2193

  Fly  2280 LKLF----SERLGSLGKIIEVLE------ATPQNCQVRALQQLAEIKSQLLLLQTYIKTADSLNT 2334
            ..||    ||.|.:|.:::|.||      ..|.:...:.|:|   |...:|.|||:.|...:   
plant  2194 NPLFFLNDSETLSTLEEVVEDLEQVLKEGVLPVSWSKKYLEQ---ISKTILQLQTHEKKQST--- 2252

  Fly  2335 GGSFEWVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYK 2399
              .||||...::.:::.|::::|::.|||:..||||:|.:.||.||:.|.|.||...:...|| .
plant  2253 --KFEWVTGMLIKAIEKGEWVVLKNANLCNPTVLDRINSLVEPCGSITINECGIVNGEPVTVV-P 2314

  Fly  2400 STNFRAFLTVDPKNGELSRAMRNRCVEL-------SLSRDTYSVDDL-----RAFVHEQGVREME 2452
            ..|||.||:|:||.||:|||||||.||:       .|:.|..:.::|     ..|:...|:...:
plant  2315 HPNFRLFLSVNPKFGEVSRAMRNRGVEVFMMGPHWQLNEDGSNCEELVLRGVERFLALSGIPGYK 2379

  Fly  2453 AIDCILRVH-----KGLS---QLTEFNNYSISHLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVY 2509
            .:..:.:.|     .|.|   ::|........||.|...::      |.:|..::.::...:|:.
plant  2380 LVTSMAKAHVHAWLNGQSFGVRITYLELEQWVHLFQLLLMN------GNQLLWSLQLSWEHIYLS 2438

  Fly  2510 SANTDLMGYGLSYYQNKLREVVLAQTEVFEEVAVIQEDFLSDVILNSGNLNSLTLIKRQAVALKV 2574
            |                     |..|:..|.|..::|.:||||.|:.                  
plant  2439 S---------------------LGVTDGKEVVDFVRETYLSDVELSE------------------ 2464

  Fly  2575 LLDGYTEGKIPQKLLASLFHEMEKLKLDQRNPQKLIRHFLYMLYESSAIGDLELRHLYLQPWLSK 2639
             ||.:..|               .|.|....|:                 ...||.|   .|.|:
plant  2465 -LDSFMGG---------------DLYLPGGWPK-----------------PFNLRDL---TWYSR 2493

  Fly  2640 DTAFQELSQNLYNCL-------QKRSNTDTGTLANLPWNRKLIPRLRDYSTAESNSEL---NPLN 2694
            :|..::      ||:       |..|:.               |::.| :....:.||   .|..
plant  2494 ETTVRQ------NCMYLEFLGAQYASHQ---------------PKISD-NVKSRDRELAAGEPRI 2536

  Fly  2695 LSALLLARLVVDIIPVSSVTTVQQMNALQYSQALCKKQVTEKYANHLLANFSSFLEVLHTSLLED 2759
            :.::....|...:.|.:.:.:....:|..:...|..|.:.      ..||::          :|.
plant  2537 IYSIDSWTLKKVLFPKALIGSSCAPDAANFENDLASKMLL------FAANWT----------IEQ 2585

  Fly  2760 LETADLDLPQYAHLVTRFHWF-NRILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHL------- 2816
            ....|:.|     .:..|.|| :|:.......|.:.|.|.|...|.:..|.....|:|       
plant  2586 ATEEDIQL-----YLAWFSWFGSRLQQHCPFLLCFLNTLKVEFEHPIWNHISRCRKNLKFLCRLD 2645

  Fly  2817 --LVPLIELTAKSGCARMLTIQDRTLKIKKYIEETRRPLNVTCKIYSKQFTQFQPYYQD-QQIQR 2878
              .||:..|::|  ...:....|::....|.:.|:...:.|..:.|.:...:....:.| ....|
plant  2646 PDAVPIPMLSSK--LIDVAASNDQSKPYSKSLFESLNSVGVLRRSYQQWLVESNDNHTDVSTFTR 2708

  Fly  2879 HIE-LDDLEK--LLSVV--PSYGNL--------ELSSWLKRWLLLQTDD---ANKW---RSFLRK 2924
            .:: |..|||  |..:|  ||:..|        :..|:....|:..:|:   .:.|   :|..:.
plant  2709 FLDSLRVLEKKILCEIVGAPSFSVLIQLYTEVIDNHSFFWSGLVSSSDEYLLFSFWSLIKSIKKM 2773

  Fly  2925 HTNGFQPKAFEI----SGSLRNETLQSHLQKLQTTLKEAQEN---SAEI--EMDLELDLNSIKTL 2980
            |:  |.|...::    |.::.|..|..|.:|..........:   |||:  :....|.|.|....
plant  2774 HS--FFPGEVQVVLEESKNINNIVLHGHPEKSMLWAYGGHPSLPVSAELFHKQQEFLQLCSTVWP 2836

  Fly  2981 LEAETEESESYIHPDGIPTNTPKLLIAALRELFMERLLTGTLRDDFD----EQVNPLYADQLLTL 3041
            |::|::|..:......||.:.|:|.:.||..|.:...:..  .||.|    .|::.:|...|..|
plant  2837 LKSESDEHGNDHLTKAIPFSGPELCLLALEGLCISSYIAD--EDDVDYVAAVQLDEIYQTFLERL 2899

  Fly  3042 NSNLWHCLKTLESANRTEITNAWIELKNEVNELQNYDEFAVLLEKIGGGYKGLRSYQRQYRNSVQ 3106
            .         ||. .|.|....:.|:.|..|...:...|...:...|.|:.              
plant  2900 K---------LEK-KRLEDKMGFSEIDNTENITASCCVFCPEIVTTGSGFS-------------- 2940

  Fly  3107 CYQLENLSTRLDCVQGPSEEGSTDISSQFCYRGPALSGVILSLICQPNGQLRSVPLSELLE--WR 3169
                   |....|....||..|.|:.        .|:.:...|:.:|......|.:.:||:  ..
plant  2941 -------SWVKTCFIASSESCSLDVE--------LLAALQHLLVARPTEHQDLVDIRKLLKPALE 2990

  Fly  3170 SALQQTR----------------------------------------HLIWENSQL--------- 3185
            .:|..||                                        .::|:|||:         
plant  2991 YSLSSTRPPQTLVAHQKLLWAIDAHASELGVDTKIAGFALEIWYWWHSVLWKNSQIGLMNISDTG 3055

  Fly  3186 --------------LTSRYSGEVNNLLQAKENARQLLKEL---EYVRKLSEKEQKANQGFENCAK 3233
                          .|:..:..:.|:...|:.:.|.:|.|   .|:.|.|:..|:......:.|:
plant  3056 NCQILSPSMLIQPVKTATVAQILENVFSVKDYSVQSMKLLSASRYLWKSSQPYQEMPGSLLSIAR 3120

  Fly  3234 EL--------EKMIEK------------LEKEENNN------------------ASMTKDF---- 3256
            .|        :|..|.            :||::|..                  .|:|..|    
plant  3121 SLFQQIIYTHQKSFESETFVAIKSVFHAIEKKQNKMDGIQNLISLIGSSSHNKLKSVTHSFVGPL 3185

  Fly  3257 -----EVSLTNAL-----------------VGAIELCLLTNTPLIDPVEKNRLKNEYIAEDIDCL 3299
                 ..|.:|||                 :|.:...||.:..:|||.                 
plant  3186 AKRLYSDSSSNALCPTFVEFYCNLGLAWLYLGGLRFHLLNSLDVIDPA----------------- 3233

  Fly  3300 STLTTAYDFMKIAMKYRHFGEEIYSELELRLRTALQRQQQLSQKLALRSEKCLYASLVQDITHFL 3364
                     |||..|.....|:| |.|||.::              :|.| |.|      ::..|
plant  3234 ---------MKITCKLLKLEEKI-SSLELNIK--------------VRGE-CGY------LSGLL 3267

  Fly  3365 HSNGDCES----LYKL-------------------FQLIHSEWENFQGLHVATSAQLKSSIEVLG 3406
            :|..:.||    |.||                   :|.:....:.|.|. :.....|.:.||||.
plant  3268 YSGNNDESSEHTLSKLKTEHKRLQRKVIFRSDPKKYQDLRRALDEFAGF-LTRPISLVNDIEVLD 3331

  Fly  3407 ------KLDLWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLESLKV---IFTRVQQAG 3462
                  ::..|...|..|:....|.||.|. |..:||:.||.:::.|| ||.|   :..::....
plant  3332 WNQVVEQVFNWQETAISFIDRMSSDYSEYV-DITQPIQVSVYEMKLGL-SLFVSGALLGKLLNRF 3394

  Fly  3463 SVSQAEQMQQTIGDIVQFPSQH------------PLVI---RNSRL------YGLLAEL-PHSEY 3505
            .:...:.:.:||..:::||...            ||.:   .|||.      .|||.:| ..|..
plant  3395 DIDMVDSVMETIYALMRFPRDSSIASTTYTECLPPLHLSHGANSRAKSLGLDVGLLHKLISVSSA 3459

  Fly  3506 EYFRLLKAKLSELSNYIALGR--------------VIDETTFAAYDDALSICNQTWQQEEHRRCQ 3556
            |..|    |.|||...:||.:              ::||.:|...|.......:.|.:   .:.|
plant  3460 EDSR----KASELQLKVALYKNLHARVLQFVANTGLLDEASFELLDKIYVELARIWME---MKFQ 3517

  Fly  3557 LKAEAES---LYVTKTKG-GVDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASA 3617
            .|.:|::   ||..:::. .:||...:::..:...||   :|.|:|:      ::.|..|...:.
plant  3518 AKTKADNLPGLYKFRSRDFKIDSVMEVDISALGKYFP---NESFSEW------QEYLADDDTKNV 3573

  Fly  3618 KD----KQSQIVVEEDYAFLARNFIDVMTRHTQVY----YKEQP-----KSSKELELHLLAPYQA 3669
            ||    .|.:..:|:|:..:..:...:.:.|.:::    ..|:.     ..|:.|: .....|:.
plant  3574 KDMTHIDQDEENLEDDWDLIQEHLDSIYSTHNELFGFCDLSEKSGRFCITDSRRLD-SFTDSYEL 3637

  Fly  3670 RFQVFANLHGHYKTALGSSLEERACNGLAFGLALQQKQLRDIELEEGVSSSPYDFYKDSNISEIQ 3734
            ...:...|.|.:.    |||:.:........|.|:.|:......:   |:|.|:||||.:..|:.
plant  3638 GVSMIKGLRGLFT----SSLDAKLVPEHLLRLCLENKKNFTSNYQ---SASKYNFYKDLDGPELG 3695

  Fly  3735 SCLDVMERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLALWNEV 3799
            ..:..:..:::|:...|::..:|.||..:..|:..:..:|:..|:.:..:|.|.|..|:   :::
plant  3696 KMVKFLTPLQQRINSLLQEREDHPGLQKLSGVLQMLLAIPSSTPLAKALSGLQFLLCKV---HKL 3757

  Fly  3800 AHRNNNL-VSEEIE-VAEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYNLLQQFIHQKQ 3862
            ......| :|:.:| :......|.::|.:.|...|.:...|.||.|.:.|..::::|.|      
plant  3758 QEEGCKLPISDLLEPIISLASSWQKVEFERWPTLLDEVQDQYELNARKLWLPLFSVLFQ------ 3816

  Fly  3863 LDHSYTDIKLAEQRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQGFEL 3927
                                .||.::.|.:...::|   .|.:|:|.|..|:|..|||||..|.|
plant  3817 --------------------KDAVEISEHENESISQ---SLVEFIETSNVGEFRRRLQLLFCFLL 3858

  Fly  3928 YLHNVERAG--KINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKDL 3990
            .|......|  ..:.....:...:|:..::.||...:.:...|.|..:|.:|||.:|:..:.:..
plant  3859 QLSMGSSLGIYSSDSHKRRVEMCYNIFGFYIQFLPVVMEQLDLNRKNVETELKEVLKLCRWERPD 3923

  Fly  3991 SYF---SMRNSVASVHRNLNKFLKEYRLSIQEKISEVFQPKDSTAKDYTFGTDKGKGLRNYNKIK 4052
            :|.   :.:.:...|.:.:.||....||.:.     :.:|.                        
plant  3924 NYLYNETTKRTRQKVKKLIQKFTDMLRLPVM-----LVKPD------------------------ 3959

  Fly  4053 YLHTERQQFV----------ASEKLLEKF--AIQEEFLSD---------NTLLQRL-----DKHF 4091
             |..||.||:          ||:..:|..  |:..|.|.|         |.|.:.:     :.|:
plant  3960 -LTKERAQFLPLLDPDLMDGASDMRIEVLVSALDAEQLRDRSSWYVVWWNKLKESVGRFHQEMHY 4023

  Fly  4092 RT----ARHVVKETLGQVPYGEL---ITELDDLLASQLERCEHLRSLNVDRSKERPQQKQEAKQI 4149
            :|    |.|.....:.|..:..|   :..:.:.:|.    |..|.. |.||.             
plant  4024 KTLLMGAEHQYSSPVYQGDWKNLWSTVARIGETIAG----CSDLWR-NSDRD------------- 4070

  Fly  4150 LQQKRKALTDLFKMLHRLG-ANYKTGLLELSLRNEFED--FQLPPYSIRSML------PRLHPTA 4205
             ..|::||.:|.|:|...| ..:|...:|:|  |.|:.  :| |.|..:.:|      ..:||:.
plant  4071 -VAKKRALFELLKLLESSGLQKHKFENIEMS--NHFKGLLYQ-PAYDPKHLLLLTHTKSNIHPSM 4131

  Fly  4206 QQLDEH----------LDLYYMKSVFKLKLLQNIMLTPLSELGPPNIERIKGFAVDLFLLVQQQR 4260
            ...|::          .:.:|.||:..::|:.||. ...|::....::|...|...|..:.:|||
plant  4132 GVEDQNKENSLVEWRVANEFYFKSLASVQLMLNID-RKHSDVTAEQVKRAISFLNHLVEIQRQQR 4195

  Fly  4261 EHLSGSTKELHELRNSLDSLRKLAEIIPQADINPSTLNFVKSADIAMEIKQHLRQIHYVLKQWKL 4325
            :......:..:..|..:.||.:|......||         :..|......|:...:...|...|.
plant  4196 KSAYAFAELFNRFRQCVLSLARLLGDSVGAD---------RKDDSVFSFPQNQHAVFNCLWLQKQ 4251

  Fly  4326 LLSCAPSSFIEESENRLLVRKISLAQSELHSLCIQILNSSQELLNELNNANLEYLSSEKCVTYQK 4390
            |.....:..:|||   .|:|  ::..:.|.| |..:..||:.||                     
plant  4252 LFDNITAMLLEES---ALLR--TVGSTHLDS-CQAVKTSSRSLL--------------------- 4289

  Fly  4391 SYAE----IQENIKKTLELLRTGQNDYL-----PLAQPIVELLDSVQLKNHTEIAPEAIDLAN-- 4444
            |:.|    |.:|.|.:|:.|....|.::     .|.|.:.:.:..|..:|..::.    ||.|  
plant  4290 SFIEILIPIAQNSKASLDRLLLDCNGFIITPSSSLKQFVTQHMVQVLRQNFDQLT----DLENQI 4350

  Fly  4445 ---ADTELANIAHSVLMS-MQKIYKH-HVKTDEVNQNGEAKEQDE--ESKEAL-QEQHLK----- 4496
               .:....:....||:| ...::|. .:..:.:|.....::|..  |.||.| .|::|.     
plant  4351 SSFCENNEKSYCRDVLLSQFSPVFKEGKLLAENLNCLLNVRDQSTGMEPKERLFLEENLASIFAN 4415

  Fly  4497 -KCLTGEL-------TSDWQQLSLPRVLG---------KLSNVLLVLKHSHFEGKDKLLCVRRAI 4544
             |.:.|:|       .|..:::::....|         .|.|:..:|..| |...::||   .:.
plant  4416 VKDVIGKLCSYKDGSLSQEEEMNITTWDGLFKKAENDLNLDNLCKLLSES-FGSIEQLL---NSS 4476

  Fly  4545 GLLPV-----LEQYQLLADYLL------LQQ-LATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLM 4597
            |:|..     |:|.|...|.||      |:: ||..|..:.:..::.:|..::.:|||.:..:..
plant  4477 GVLSAGVGDQLKQLQAFLDLLLSFGDCYLKEFLAISKTVSLITHVLASVLADLFTKGFGISKNEE 4541

  Fly  4598 QDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRPEDRKDEGDKQEPD-CKEEKGI 4661
            .|:....|.|:..|.|.|  ||.|..|.||:||.||||...    |:|:|.:|::.| ..:.|||
plant  4542 DDDSKVDKSEAAEGTGMG--DGVGAKDVSDQIEDEDQLHGT----DKKEEEEKEQDDVLGKNKGI 4600

  Fly  4662 EMSDDFDAKMQDV-EKPEEDDSGESEEEEDLNKEMGETEEGAEKLDDQIWGDDEEEKPEEEQEPD 4725
            ||||:||.|...| |..|||...|..|:|.|:..:|:....|||.|::.|..|     ||::|.:
plant  4601 EMSDEFDGKEYSVSEDEEEDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNKD-----EEDEEEN 4660

  Fly  4726 MNEEDQGKGSKDEKDAHNDLDTKNDAAKEDG---KDEHEKDGLDATNEP-SGEDKRKEQAKDIDD 4786
            |||:::...|..:||..    ::...||:||   .||.|:.  :.:::| .|.|:..||    ||
plant  4661 MNEKNESGPSIVDKDTR----SRELRAKDDGVETADEPEES--NTSDKPEEGNDENVEQ----DD 4715

  Fly  4787 MKDPEMDEEQTNAMHNELEEPPEPEEMDLG----DMNNVDEGHDDQDEQPTDENPFDIDAMKENM 4847
            ..|.:           .|||..:.:|..||    |::| ::..||.:...|:|      ..||:.
plant  4716 FDDTD-----------NLEEKIQTKEEALGGLTPDVDN-EQIDDDMEMDKTEE------VEKEDA 4762

  Fly  4848 QPAEEPEADG-----DDEHDANEEGDPQSDGSDSE-EDEAGTEAKPAEEDHGEGEEATPEDEKDE 4906
            ...|||.::.     :.|:|..|..:|..:..::| ||..|:   |.:|:.|...|..||.|..|
plant  4763 NQQEEPCSEDQKHPEEGENDQEETQEPSEENMEAEAEDRCGS---PQKEEPGNDLEQEPETEPIE 4824

  Fly  4907 AETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSAD 4971
            .:     |:..||..|| :...|:....|...:.....:.......:.:||:.:...||:.:  |
plant  4825 GK-----EVMSEDMMKP-NFRNDNISGVESGSQNPHGSNVLGAGSTAPQENLSATDVTDELT--D 4881

  Fly  4972 QVQQPQDPDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQTQEKR 5036
            .:..|...:.:.:..:.....||                    ..|......|..:|:..|.:  
plant  4882 SMDLPSSSNTEMNLMMTNMANGE--------------------TLTDNLPKMEFPQNQSSTAQ-- 4924

  Fly  5037 KQGRTNEERSLGEAEQNKLKQLKTIDQL-KDSKESDDAEQEKPEPMDQTEAEEYQHVKEPKNSDK 5100
             |.:.|..|::|:|    ||:.|...:: .|..|..:||.|..:|    :|.||....:......
plant  4925 -QTKVNPYRNVGDA----LKEWKERVRISSDLGEKQEAENEMEDP----DASEYGFASQFDAGTS 4980

  Fly  5101 TTLDNATEEQSKKIQHQEDEPPNEEEIEAENVDELMEAEEPAVDPEDDAELEQLGAEKTEQKSDK 5165
            ..|..|..||           .|.:..|.|:.:|.:...:..|.|.|   ::.|..|.......|
plant  4981 QALGPALPEQ-----------VNTDMREGESEEEKLAGNQDDVSPMD---IDDLNPENKPAVQSK 5031

  Fly  5166 PSKTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETTAHSNSEILLDKSSHAEDLSSAEQIELRQQ 5230
            ||.:....||::.|:......|   ...:....:..:..:|.:.:|.:...|:..:.:::::...
plant  5032 PSISNSIAEQVQEPDTDRTHQE---NSPIHNFGDGNSRMDSMVSVDNTFLGEEACNLDRMQVTDN 5093

  Fly  5231 YQKQLTTFRVAQPEHEDYET-------WQGISNRMTQNARELCEQLRLILEPTKCTRLKGDYRTG 5288
            ..:.      .|...||.:.       |:.......:.::||.||||||||||..::|.||||||
plant  5094 DSES------NQDNQEDPDARSNAVVLWRRCELLTAKPSQELAEQLRLILEPTLASKLSGDYRTG 5152

  Fly  5289 RRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKSMHHNNSKTLTLEAISLVSQAL 5353
            :||||||:||||||.:||||||||||||.:|||::.||:|||:||..:......:.|::.|.:|:
plant  5153 KRINMKKVIPYIASHYRKDKIWLRRTKPNKRDYQVVIAVDDSRSMSESGCGDFAIRALATVCRAM 5217

  Fly  5354 TLLESGRLSIVSFGEAPQIILNH-------TEQFDGPRLVNALNFAQDK-TKIAGLLNFIRTAN- 5409
            :.||.|.|::.|||:...|.:.|       ||  .|.::::.|.|.|:. .:...::|.:|..| 
plant  5218 SQLELGSLAVASFGKQGSIKMLHDFGQSFTTE--SGIKMISNLTFKQENLIEDQPVVNLLRNMNE 5280

  Fly  5410 ------AEESGTGGDNGLFENLLLILSDGRNIFSEGAQNVKNAIKLARLQRIFLVYIIIDNPDNK 5468
                  :....:.|.|.| :.|:||:.||:  |.| .:.:|..::....|:..:||:::|  |.:
plant  5281 MLENLASTRRQSYGSNPL-QQLVLIIGDGK--FHE-REKLKRTVRSFLQQKRMVVYLLLD--DAE 5339

  Fly  5469 NSILDIQHVAVNADGS---VNINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELVNS 5525
            .|:.|:.....  ||.   ....:||||||||||:::||:..||..|.:.:||||||:.|
plant  5340 QSVFDLADYVY--DGERRPYKKMNYLDSFPFPYYIVLRDIEALPRTLGDVLRQWFELMQS 5397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1576/5861 (27%)
P-loop_NTPase 315..505 CDD:304359 60/197 (30%)
P-loop_NTPase <887..972 CDD:304359 45/86 (52%)
P-loop_NTPase 1147..1283 CDD:304359 94/136 (69%)
P-loop_NTPase 1454..1603 CDD:304359 89/231 (39%)
P-loop_NTPase 1795..1946 CDD:304359 88/151 (58%)
P-loop_NTPase <2335..>2378 CDD:304359 16/43 (37%)
Prothymosin 4843..4920 CDD:281265 24/83 (29%)
PHA03151 4856..5060 CDD:177546 43/210 (20%)
MttA_Hcf106 <5046..5166 CDD:294511 28/121 (23%)
vWA_midasin 5261..5526 CDD:238737 116/284 (41%)
AT1G67120NP_001322748.1 MDN1 352..>2344 CDD:331582 795/2296 (35%)
Utp14 4673..>5015 CDD:331853 96/423 (23%)
DnaJ <4689..4831 CDD:333066 45/174 (26%)
vWFA 5126..5398 CDD:320736 116/283 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D138219at2759
OrthoInspector 1 1.000 T192795
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.