DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and vwa8

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001121810.1 Gene:vwa8 ZFINID:ZDB-GENE-070912-407 Length:1896 Species:Danio rerio

Alignment Length:2273 Identity:432/2274 (19%)
Similarity:732/2274 (32%) Gaps:800/2274 (35%)


  Fly   375 SKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLTQAVMH 439
            :||::|.|.|..     :||            :||.|.     |.....|...::.....:|...
Zfish   119 TKREVEYVALSR-----DTT------------ETDLKQ-----RREIRSGTAFYIDQCAVRAATE 161

  Fly   440 GYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASNSSQKSL- 503
            |..|:||.|:.|.::...:|::|||.:         .:::|.|..|....|.:|.....:::.| 
Zfish   162 GRILVLEGLEKAERNVLPVLNNLLENR---------EMQLEDGRFLMSAHRYDKLLEEHTKEELD 217

  Fly   504 ----YSLLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSS--------GNHTS 556
                ..:.:.:......||:.|   .|...::.|..|....|.: .:|.|..        |.:.|
Zfish   218 AWKIVRVSEDFRVIALGLPVPR---YKGNPLDPPLRSRFQARDI-YYLPFKDQLEHLYRIGANVS 278

  Fly   557 ADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSECAYF 621
            |:.:.|..|......:::..:|.....|:.:.|::   ::..:|.       |..||        
Zfish   279 AERVSQLLSFATTLCSQESASLSLPDFPVDNLPSA---LTVLNLF-------PMLSV-------- 325

  Fly   622 VFQNAVDVFCSYLPQ-SKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRASLLA 685
              |..|.....|... .||..|.:..:     :.|......:.:..|.....:|.:..|:|...|
Zfish   326 --QQLVQRLYPYEAMLGKEGRTAVEGV-----LNRFELTDGSTKPSPTAVVNIEPVNGGQAEQAA 383

  Fly   686 KSDLNNSENEDISEQDLKRQKLSQQT---RRAIGKVSNKRTTFSFT----RLASCILERIAVCVT 743
            .: ||           :..||::.|.   .|.| :..|...||..|    ||.:.:::...|   
Zfish   384 VT-LN-----------ITNQKITFQVPSGTRPI-RPPNSSPTFINTPTHERLLAEMMQSHLV--- 432

  Fly   744 HSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVELNYVL-------- 800
              :.:.|:|..|.||:...:..||...:.:..|.:.......||      ::..|.|        
Zfish   433 --KDICLIGAKGCGKSVIAREFAEMLGYSIEPVMLYQDMTARDL------LQQRYTLPNGDTAWR 489

  Fly   801 -APLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPEL---KANKL 861
             :||         .|..||..|..|        .|.|.|.:.|:. :..::..:.||   ...:|
Zfish   490 ASPL---------VTAAQEGKLVLL--------DGIHRVNLGTLA-VLSRLLHDRELDLYDGTRL 536

  Fly   862 L--PRWQTLREKLQKLQMQL-DKSINISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLSTI 923
            |  .|:|.|:|:||....|| |:||                                        
Zfish   537 LRFDRYQALKEELQLTDQQLQDRSI---------------------------------------- 561

  Fly   924 LEPEGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNRFTEFFVDELTT------ 982
                           .|:  ||.|||.|...|         || |.:...::...|:.|      
Zfish   562 ---------------FPI--HPSFRIIALAEP---------PV-IGSTTQQWLNPEILTMFLFHT 599

  Fly   983 -----DADLSLLVSDYLANTGIQRKSVHNIVQLYKSLRKLSE---LQLNDGLGNRPVYSLRTLCR 1039
                 .|:.:.::...:.|  :..::|..:..|..||||.::   |.|...|..|.:        
Zfish   600 IKPLAKAEETAVLQGMIPN--VPGEAVEQLQHLTHSLRKSNDPTALSLASSLSTRQL-------- 654

  Fly  1040 SLRICARNLCGSIERNLYESFCLSFLTQLDPNS-HHVVLLLIQNALLSNVKAILSKQLPQLGENY 1103
             ||||.|                  |:|....| .|.|           .||.||:.||.|..:.
Zfish   655 -LRICRR------------------LSQYPQESVAHAV-----------HKACLSRFLPSLARSS 689

  Fly  1104 LD-------FEGYWIQPGNLEPQPCTH--YILTESVKKNL------------------------- 1134
            |:       .|.:        |.|.:.  .:.|.:||..|                         
Zfish   690 LEKSLANCSIEDH--------PDPASEQKQLYTCTVKDGLLTIGNVSAPVYSPDEKMKVPDVLFY 746

  Fly  1135 ---------KDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGT 1190
                     :|:.:...:|: .:||.|....||..::|        |.|.:.|.....||.:..|
Zfish   747 ENVQHMMVMQDMLKDFLLGE-HLLLVGNQGVGKNKIVD--------RFLHLMNRPREYLQLHRDT 802

  Fly  1191 YAADL-------DGKLTFREGVLVQAMRHGFWIILDELNLASTD---ILEAL----NRVLDDNRE 1241
            ....|       ||.:.:.:..||:|::.|..:::||.:.|.|:   ||:||    ..:|.|.|.
Zfish   803 TVQTLTLQPSVRDGIIIYEDSPLVKAVKMGHILVIDEADKAPTNVTCILKALVESGEMILADGRR 867

  Fly  1242 -----LYIAETQTLVKAHPNFMLFATQNPPG-------LYGGRKTLSRAFKNRFIELHFADIPRE 1294
                 |..|.....:..||:|.:....|.||       .:|   .|...|     ..|..|.|:.
Zfish   868 IVSDALEAAGRPNAIPMHPDFRMIVLANRPGFPFLGNDFFG---ALGDIF-----SCHAVDNPKP 924

  Fly  1295 ELETILEKRC--FIPPTYARKMVQCMTQLQ-QHRKNTSKQVFTLRDLFRWGNRYTHADKSLHDDN 1356
            :.|..:.|:.  .:|....:|:|....:|: ...:.|....::.|::.   |...|..|      
Zfish   925 QAEFAMLKQYGPDVPDAVLQKLVAAFGELRAMADQGTITYPYSTREVV---NIVKHLQK------ 980

  Fly  1357 RYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFDIQTDRESSSMVSRKILD 1421
                   ..:||   |::.||:                       :||..:..:....|   ::.
Zfish   981 -------FPDEG---LANVVRN-----------------------VFDFDSYNKDMREV---LIS 1009

  Fly  1422 AIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTV----------CQL----- 1471
            |:....:                               |.|...|:|          |::     
Zfish  1010 ALHKHGI-------------------------------PIGAKPTSVHLAKELPLPDCKMTGYWT 1043

  Fly  1472 LASIADVQLRILNCHMHTEGADFLGG--LR----PCRGKESTQLFEWADGPLIYAMQEGSYFMAD 1530
            ::...:.:.::| |...|...|..|.  ||    |.:..||..| .:.:....:.:......:..
Zfish  1044 ISQGGNTRRKLL-CPTETHRIDIKGPVFLRVQSYPSKRHESRSL-SFTEEQAHWQIPMNEVNIVC 1106

  Fly  1531 EISLAEDSVLERLNCILEPERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKEL 1595
            :::.|:||:                                        ::||.||...:..||.
Zfish  1107 DVTTAKDSI----------------------------------------YVATCNPVSLYAMKEK 1131

  Fly  1596 SPALR---------NRFTEVWCLPSDNKEDLIEIAY--NCMRRQKE-HENQAINTHKVAEYLVDV 1648
            ..:::         ...:.||       :..:.:|.  |.::.|.. ||.|. ||....:.:...
Zfish  1132 GDSVQCIELYDIFPRTISGVW-------QPFVSVAALGNPLQDQVVLHEEQG-NTVLHLDLVTGA 1188

  Fly  1649 VLHIRDTNDKFKFSVRDILAWANYMVSNAKLSFAEQAIFGLETIF-------LDALEMLPHESQE 1706
            |..:..:.||...:.|....|.|...|.......::.......:|       ||.:::|  |.|.
Zfish  1189 VRRLILSQDKQDEAPRKTSNWWNSKESQPGYKMCKEFAHKNWLLFYKENGNQLDVVDVL--EGQV 1251

  Fly  1707 QVELLKSNIVKQAIKQASLILQEKFTLEELSEKR----------GTEVELNECRFGIRPFFIDVN 1761
            ....|..|     :|...|:.::::.|.|....|          |.| |...|            
Zfish  1252 HTIHLPIN-----LKAVFLVAEDRWLLVESKTDRKFLLTKPMHMGAE-ETGVC------------ 1298

  Fly  1762 QERLTSAKEDFLFDAPTTKQNLFRLLSALSLQKPVLLEGPPGVGKTSIV-ESIGSAIGYQIVRIN 1825
              :|.:..||.:.........    :.|:|         |..|....:. |::.:|:|.:||..|
Zfish  1299 --QLHAISEDAVSSGFGNNSG----MEAVS---------PQEVSSDQLSNENLSAALGQKIVSPN 1348

  Fly  1826 --LCEHTDLADLF--GTDLPAEDNL--LESNTAATERQIRSFVW----RDGPLLAALKAKNTWIL 1880
              ||:....|::.  ..||.:.:.|  ...:...||.:.....:    |.||    .|..|...|
Zfish  1349 RILCDTNTYANVIVGFPDLMSPNELYSFRRSLPITESRRPDMFFGSSKRTGP----AKRVNCVCL 1409

  Fly  1881 LD-----------ELNLA---PQSVLEGLNAV------LDHRGEVYIPELNKSFHLAGSTRIFAC 1925
            ||           ::.||   |:.|...::|.      |:.:...|||                 
Zfish  1410 LDANQVVRALPPTQVPLAEVYPKDVTPPMSAAYLEVTDLNSKRLKYIP----------------- 1457

  Fly  1926 QNPLKQGGGRKGLPQS-FLNRFTKVYLRKLSTEDLL-------HVVTEKYGKY-------FDQLN 1975
                        :|:| .::.:| |::.|:|..|::       .|||...|.|       .|.|.
Zfish  1458 ------------VPRSNSMSPYT-VWISKVSDTDVVMAPLGSGGVVTVDMGGYVRLWETGLDHLQ 1509

  Fly  1976 AYFLELLDQ--KAEGNLFEIY----SGKE-SSCKSDSFDLGARLVRFSEQLDRGVASME---FGY 2030
            ...||..:.  ..:|...:|.    ||.: ||.|....|..........|...|....:   .|.
Zfish  1510 RSLLEWRNMIGSEDGRPVQITIERDSGLDVSSPKHGKIDAKNAPHVGGNQWAGGTGGRDTAGLGG 1574

  Fly  2031 KGGPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKS 2095
            |||||..:                            |..|.:.::..|:..:.       |:.|.
Zfish  1575 KGGPYRLD----------------------------AGHKVYQISQAEKDAVP-------DEVKR 1604

  Fly  2096 YIRNVFSTVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQADVLD----LVNRQEQS-PLL 2155
            ..|::....|                     |..|.::.:|...|...|    .|.||.|| .::
Zfish  1605 AARDMAEQAF---------------------KQRLKEIEMSEYDASTYDRFSGAVRRQVQSLRII 1648

  Fly  2156 LDS------QRQQLK----------QIIETVHMEKPLLL--------CGSTDSGKTKLIDALCVL 2196
            |||      :||.|:          :||:.:..||.:..        .||... |.|.:..|..:
Zfish  1649 LDSLQAKGKERQWLRNQALGELDDAKIIDGLTGEKSIYKRRGELEPELGSPQQ-KPKRLRVLADV 1712

  Fly  2197 SNRLCNTDIIDDSVTGSFQQI----------------DLNRH------LEIIYKKVETLVFSCVQ 2239
            |..:...:.:|..:..|.:.:                |:..|      :|::  :.:.:..:..:
Zfish  1713 SGSMYRFNGVDGRLERSMEAVCMVMEALESYEHKFKYDITGHSGDGFDIELV--RCDKVPKNNKE 1775

  Fly  2240 RAFVL---HTQSEFVEQ----LWNNWSMYNKLAKVTTEAQQH--SVLDELKLFSERLG-SLGKII 2294
            |..||   |..|:|...    |........:||.  .||.:|  .||.:..|  ||.| |..:..
Zfish  1776 RLKVLKTMHAHSQFCMSGDYTLEGTEHAIRELAH--EEADEHFVIVLSDANL--ERYGISPDRFA 1836

  Fly  2295 EVLEATPQ-NCQVRALQQLAEIKSQLLLLQTYIKTADSLNTGGSFEWVDS--------QIVTS 2348
            .||.:.|| |.....:..|.:...:|         ..:|..|.||..:|:        ||.||
Zfish  1837 RVLTSNPQVNAFAIFIGSLGDQADRL---------QKTLPAGRSFVAMDTKEIPQILQQIFTS 1890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 432/2274 (19%)
P-loop_NTPase 315..505 CDD:304359 29/135 (21%)
P-loop_NTPase <887..972 CDD:304359 11/85 (13%)
P-loop_NTPase 1147..1283 CDD:304359 41/162 (25%)
P-loop_NTPase 1454..1603 CDD:304359 25/179 (14%)
P-loop_NTPase 1795..1946 CDD:304359 35/183 (19%)
P-loop_NTPase <2335..>2378 CDD:304359 8/23 (35%)
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
vwa8NP_001121810.1 AAA_5 97..253 CDD:285029 35/168 (21%)
AAA_5 434..577 CDD:285029 46/233 (20%)
AAA_5 767..914 CDD:285029 40/158 (25%)
vWFA 1704..1893 CDD:294047 43/203 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.