DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and mdn1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_003200751.2 Gene:mdn1 ZFINID:ZDB-GENE-041001-138 Length:5527 Species:Danio rerio

Alignment Length:6045 Identity:1919/6046 (32%)
Similarity:2968/6046 (49%) Gaps:1046/6046 (17%)


  Fly     3 VNVSKLRLGA-QRLLELTANESEDNVFSQSLQKFIKKQKYVPQDVERLFRSLSEQLPLPAYTVPI 66
            :.:|...||| .|.::.:.||         |.|::.||.:..||.:.:...|::.|....||:.|
Zfish     4 LELSLTSLGAISRHIDKSQNE---------LSKYLAKQIWSQQDRQCILECLAQLLLEKEYTLLI 59

  Fly    67 AASFEEQLLLLLSMALRWDSASQRFH--TYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEKQ 129
            |......:|.||........|..|.:  .::..|||||||:|.|.|||.||..||...|..|::.
Zfish    60 ARHLRPLILDLLERNAERIKADIRLNHDLHERLCVALSKLLNISPDAQVFAARYFSSSPPVFQRL 124

  Fly   130 QSNGSLPSKKSKNGNHAADNLDDLELIKCCFQLLKSDTPYFRELWDWSSFIATYTHNSSSPKTQL 194
                ...|:::.:..:....:...:|:....:.|:||...||.|||||:.::...  :|....:.
Zfish   125 ----FFTSEEAASIQYGPRRMKLRDLMGATLRFLQSDCEKFRVLWDWSACVSQLL--TSDVMVRS 183

  Fly   195 YCNYIVAMLTNMSAPQ------------------LNSLNE--KISTKTRLEFDQEREQAWNTARN 239
            |....:|::::|:..|                  :.||.|  ::..:..|....:....|...| 
Zfish   184 YTAQCLALVSHMTDNQKTIFLRKVLSSEEILHLKMKSLEEVQQLEVEKALVLANQGSAIWRKER- 247

  Fly   240 TLCSYTPDASDQLLNLHLHGINKSVTNIEGVLLPTFNEENLEFYASTDGCYDRIVKVDSTVVNLR 304
                .....|.|::.   ..:.||||.:.||:||.......|     ..|...:|.||||..|||
Zfish   248 ----VKKVTSGQVVT---EDLTKSVTVVCGVILPRRTPRQDE-----QKCLRNLVLVDSTCQNLR 300

  Fly   305 SIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIESREKALKKAEEEEQLLTPKKK 369
            .:|:.||:.|||.|.||:|||||.|:||||..||.:                             
Zfish   301 RLAMAVASQKPILLEGPIGCGKTALVEYLAAVTGHV----------------------------- 336

  Fly   370 AKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLT 434
                                     |....|::|||||||||||||.||||||||:|||.||.||
Zfish   337 -------------------------KAPDILKVQLGDQTDSKMLLGMYRCTDVPGKFVWQPGSLT 376

  Fly   435 QAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRT--NKSASN 497
            |||..|||:||||:|.|..|..::|..|:|.:.|::||..|.:::.|.||.|.|.||  :..|.:
Zfish   377 QAVSKGYWILLEDIDHAPLDVISVLLPLMENKKLTIPGREDCIQMSPAFQFFATRRTFYSGGAWH 441

  Fly   498 SSQKSLYSLLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSSGNHTSADNLRQ 562
            ..|.:..:|||||...:.|..:||.||.:::...:|.|:.|.:|::|::... :||....::..|
Zfish   442 RPQNTHAALLDKYWSKLQISNMSREELTQVLIKRFPNLAVVVDRLLDIYCQL-TGNRHQINSSSQ 505

  Fly   563 QESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSECAYFVFQNAV 627
            ..|..::.:.:...:|            .||.:|.|||:|.|.|....|..:.:..|..|||.|:
Zfish   506 GPSAAQSISDDHITSL------------EGRGLSLRDLLKWCERICLNFESSCASTAQNVFQEAL 558

  Fly   628 DVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRASLLAKSDLNNS 692
            |.|.:.|.:|:.::.:...||::|.|.:.:.:||...|.|.:......:.:|||.||.|      
Zfish   559 DCFTAMLSKSESRLKMAEIIGSRLNISKEKAQHFCQMYLPAITVTELEVTVGRAMLLRK------ 617

  Fly   693 ENEDISEQDLKRQKLSQQTRRAIGKVSNKRTTFSFTRLASCILERIAVCVTHSEPVLLVGETGVG 757
                  :.|..|..:.:|             ||:.||.:|.:||:::||||..||:|||||||.|
Zfish   618 ------QSDAVRLSIDRQ-------------TFAATRPSSVLLEQLSVCVTKGEPILLVGETGTG 663

  Fly   758 KTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVELNYVLAPLRNEFEYLLCETFNQEKNLQ 822
            |||:|||||..|.|:|.|||||.|||.:||:||:|||:...:|.|||..||.|..:|:::::||.
Zfish   664 KTSTVQYLAGLTGHRLRVVNMNQQSDTADLLGGYKPVDHKLILLPLREAFEDLFSQTYSRKQNLT 728

  Fly   823 FLRLFATHYNSGRHAVIIRTMINICLQVAKNPEL--KANKLL--PRWQTLREKLQKLQMQLDKSI 883
            ||....|.:...|...:::.|.::| :.|...||  |.|..|  .:|:.|..||.:.|.|:....
Zfish   729 FLGHVQTCFRGKRWQDLLKLMDHVC-KSALTKELHDKPNAALLQEQWEALALKLSQTQEQIRACE 792

  Fly   884 N-ISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLSTILE-PEGSVVLLERGDFTPVKRHPD 946
            : :.|||:.|:|...:..|:|:||||||||:||||||||.:|| ..||:|||:|||..|:.||.|
Zfish   793 SAMVFAFVEGTLAQAVKKGEWILLDEINLAAAETLECLSGLLEGSSGSLVLLDRGDTEPLFRHSD 857

  Fly   947 FRIFACMNPNTDIGKKDLPVGIRNRFTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQLY 1011
            ||:||||||.||:||::||:||||||||.:|:||.:::||.:||||||....:.|..:|.|:..|
Zfish   858 FRLFACMNPATDVGKRNLPLGIRNRFTELYVEELESESDLRILVSDYLKGLNLSRGIIHGIISFY 922

  Fly  1012 KSLRKLSELQLNDGLGNRPVYSLRTLCRSLRICARNLCGSIERNLYESFCLSFLTQLDPNSHHVV 1076
            .::||.:..:|.||.|::|.||||||||:|:..|.:.|.:|:|:|||.||||||||||.:||.:|
Zfish   923 LAVRKEANTRLVDGTGHKPHYSLRTLCRALKFVASDPCYNIQRSLYEGFCLSFLTQLDRSSHPIV 987

  Fly  1077 LLLI-QNALLSNVKAILSKQLPQLGENY-LDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLAR 1139
            ..|: |..|..|||. |.:.:||..:.. :..:.||:..|:.||.....||||.|||.|||||||
Zfish   988 QKLVCQYILGGNVKC-LRQPIPQPKDRVCVQIDEYWLSQGDKEPAVDPSYILTPSVKLNLKDLAR 1051

  Fly  1140 IISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFREG 1204
            :::.|..|:||||.||.||||||.::|..:||:|:|||||||||:|||||.|::|..|||.|:||
Zfish  1052 VVAAGIHPVLLQGETSVGKTSLIKWLAASTGNQCVRINNHEHTDIQEYIGCYSSDEHGKLVFKEG 1116

  Fly  1205 VLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGLY 1269
            ||:.|||.|:||||||||||.||:||||||:|||||||::||||.:|||||.|||||||||||||
Zfish  1117 VLIDAMRKGYWIILDELNLAPTDVLEALNRLLDDNRELFVAETQEVVKAHPRFMLFATQNPPGLY 1181

  Fly  1270 GGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTSKQVF- 1333
            ||||.|||||:|||:||||.::|..|||.||.:||.:||:|..|:::.|..||..|:.:|  || 
Zfish  1182 GGRKVLSRAFRNRFVELHFNELPSSELENILHQRCSLPPSYCSKLIKVMQDLQSLRRGSS--VFA 1244

  Fly  1334 ------TLRDLFRWGNRYTHADKSLHDDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFAN 1392
                  ||||||||..||...::|   ::..||.|||.::||::|:.:||..||...|:..|..:
Zfish  1245 GKHGYITLRDLFRWAERYRLEEQS---ESSRDWLQHLADDGYMLLAGRVRKPEEAVTIQNILEKH 1306

  Fly  1393 FRKKLDLQTLF-DIQTDRESSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVL 1456
            |:|.::...|| :.|...:.|..|: .|......|   ..:|||:.|.|:||:..:||.|.|.||
Zfish  1307 FKKTVNPDALFSEGQVTSQFSPFVN-SIAGVPEEF---GHVVWTQGMRRLAVLVGRALRFGESVL 1367

  Fly  1457 LVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPCR-------GKESTQLFEWAD 1514
            |||.|||||||:|||.|::|..:...||||:|.|.:||||||||.|       ..|..:||||.|
Zfish  1368 LVGDTGCGKTTICQLFAALAGQKFFSLNCHLHMETSDFLGGLRPVRHTGTQQADAEDGRLFEWHD 1432

  Fly  1515 GPLIYAMQEGSYFMADEISLAEDSVLERLNCILEPERTVLLAEKG-GISELDASPDFVVQAKSGF 1578
            ||||.||::...|:.||||||:||||||||.:||||::::||||| |..|::     ::.|.:.|
Zfish  1433 GPLILAMKQDGVFLMDEISLADDSVLERLNSVLEPEKSLVLAEKGSGDEEVE-----LIIAGNKF 1492

  Fly  1579 QFLATMNPGGDFGKKELSPALRNRFTEVWCLPSDNKEDLIEIAYNCMR---RQKEHENQAINTHK 1640
            :.:||||||||||||||||||||||||:||..|:::.|||:|..:.:|   ...:|::|.   ..
Zfish  1493 RLVATMNPGGDFGKKELSPALRNRFTEIWCPQSNSRNDLIQIIQHNLRPGLSLDQHDHQG---KD 1554

  Fly  1641 VAEYLVDVVLHIRDTNDKFK----FSVRDILAWANYMVSNAKLSFAEQAIFGLETIFLDALEMLP 1701
            :||.::|.:..:  ||.:|.    .||||||:|.|:|.:..:..         |..|:...|:  
Zfish  1555 IAELMLDFIDWL--TNQEFGRRCILSVRDILSWVNFMNTVCERD---------EDGFMTMGEL-- 1606

  Fly  1702 HESQEQVELLKSNIVKQAIKQASLI------------------LQEKFTLEELSEKRGTEVELNE 1748
             |.:|....||.:.|...|..|.|:                  :..|.:||.|.::.....||:|
Zfish  1607 -EEEEPDWDLKLDTVTAFIHAACLVYVDGIGSGTTVSAAENALVARKLSLEYLEKRLSRITELDE 1670

  Fly  1749 CR---------------------FGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLFRLLSALSL 1792
            ..                     |||.||:|....|....:..|:...|.||..|..|:|.||.|
Zfish  1671 EMQEAIRVYNTSVSREPQWGEGFFGIDPFYIAAGSESEGRSLSDYALSAGTTAVNAQRILRALKL 1735

  Fly  1793 QKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAATERQ 1857
            |:|:||||.|||||||:|.::..|.|..:|||||.|.||:.||||||||.|..           :
Zfish  1736 QRPILLEGSPGVGKTSLVAALAKASGNHLVRINLSEQTDVTDLFGTDLPVEGG-----------K 1789

  Fly  1858 IRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKSFHL-AGSTR 1921
            ...|.||||||||.|||.: ||:|||||||.|||||||||..|||.|:|||||...||: ...|:
Zfish  1790 GGEFAWRDGPLLAGLKAGH-WIVLDELNLASQSVLEGLNACFDHRAEIYIPELGMRFHVQQEKTK 1853

  Fly  1922 IFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLNAYFLELLDQKA 1986
            ||.||||..|||||||||:|||||||:||:..|:.||:..:                        
Zfish  1854 IFGCQNPFTQGGGRKGLPKSFLNRFTQVYVDALTNEDMQFI------------------------ 1894

  Fly  1987 EGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGV-ASMEFGYKGGPYEFNLRDILRWCDLLH 2050
             |:  .|:...:::..|       ::|:||.:|.:.| ...::|.:|||:||||||:.|||.|:.
Zfish  1895 -GD--SIFPNIDNAIIS-------KMVQFSNRLVQEVMVDRKWGQRGGPWEFNLRDLFRWCQLMQ 1949

  Fly  2051 NPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSYIRNVFSTVFLCDAEYLNQV 2115
            ..|       ||..|...         :.:.|||..|||.:.||:.:..||..||          
Zfish  1950 TDQ-------SPGFFNPG---------QHVGLVYADRMRTEADKAQVLAVFRKVF---------- 1988

  Fly  2116 SNDVALYWTADKVYLNDVVLSRKQADVLDLVNRQEQSPLLLD-------SQRQQLKQIIETVHME 2173
            ..|...|..:.:.::..:.|....:    ::.|...:|:.||       ...:.|:.:::.|.|.
Zfish  1989 GEDFEPYMGSRQFHITPLNLQLGYS----VLQRSGGAPIALDPPLSITHHSLRPLEALMKCVEMG 2049

  Fly  2174 KPLLLCGSTDSGKTKLIDALCVLS-NRL----CNTDIIDDSVTGSFQQIDLNRHLEIIYKKVETL 2233
            ..::|.|.|.|||:.|:..|.:|: :||    .|:.:....:.|.|:|:|:.|..:.:.:.::.:
Zfish  2050 WMVILVGPTASGKSSLVHLLALLTGHRLRVMAMNSAMDTTELLGGFEQVDIIRPWQQVLESMDYV 2114

  Fly  2234 VFSCVQRAFV-LHTQSEFVEQLWNNWSMYNKLAKV----TTEAQQHSVLDELKLFSERLGSLGKI 2293
            |....:|..: |....:..|.|.:.||.:.:..:.    |||.|         |..|.|..|..|
Zfish  2115 VAMVTRRGLMSLDGAVQDTEFLLSTWSTFRRWLREEGLDTTEGQ---------LTFEALNKLEVI 2170

  Fly  2294 IEVLEATPQNCQVRALQQLAEIKSQLLLLQTYIKTADSLNTGGSFEWVDSQIVTSLKCGQYILLE 2358
            |.:|...  |.:::....:::::....||:..:.......|.|.|||:|..:|.:|:.|.::|::
Zfish  2171 IVLLHKL--NTKLKVFTDMSKLQMDFTLLKERLAQMQDGWTHGGFEWLDGTLVQALQAGDWLLMD 2233

  Fly  2359 HVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYKSTNFRAFLTVDPKNGELSRAMRNR 2423
            :||.||.:||||||.:.||.|||.|.|:|| ...:...:....|||.|||:||.:||:|||||||
Zfish  2234 NVNFCSPSVLDRLNALLEPGGSLTINERGI-IDGTTPTITPHPNFRLFLTMDPTHGEISRAMRNR 2297

  Fly  2424 CVELSLSRD----TYSVDDLRAFVHEQGVREMEAIDCILRVHKGLSQ-LTEFNNYSISHLTQFAF 2483
            .||:.:..:    .:...||:..:|..||......|.::.:|..:.: :.:....|:|.|...|.
Zfish  2298 GVEIYIPGEHEGVCWDTLDLKMVLHTLGVTGDCVCDLLISIHSEIKKTIWDSPASSMSSLLHAAS 2362

  Fly  2484 LSAAYRRIGYELKRAIYVAAMEVYVYSANTDLMGYGLSYYQNKLREVVLAQTEVFEEVAVIQEDF 2548
            |.:...:.|.:|..|:..|..|.|             ::.|..:....|||..:..::||:..:.
Zfish  2363 LLSGQLQRGVDLPSALLQACGEAY-------------AFCQRTIANQQLAQEVIERQLAVLDSED 2414

  Fly  2549 LSDVILNSG----NLNSLTLIKRQAVALKVLLDGYT----------EGKIPQKL-LASLFHEMEK 2598
            ....:|.:|    .:.|..:....:....|..||..          .||..:.| |..|...|:.
Zfish  2415 WGSGLLCAGVWPDRIPSALMCTEDSCFSSVQRDGQVLLYCLNTLSLYGKRSRPLSLVDLQRAMQS 2479

  Fly  2599 --------------LKLDQRNPQKLIRHFLYMLYESSAIGDLELRHLYLQPWLS---------KD 2640
                          |.....|...|:...:.:|.|.::..|..||    ..|:|         .|
Zfish  2480 GAVLDGLQFSGGGGLDGGAENALLLLPTAVKILTERASHSDWVLR----TSWISHLTKTYKHAPD 2540

  Fly  2641 TAFQELSQN------------------LYNCLQKRSNTDTGTLANLPWNRKLIPRLRDYSTAESN 2687
            ||...|...                  |...||..|..|...|.::.||::.:..|.:....|..
Zfish  2541 TALMLLEAGCTALKAIFSSKLIGKGKCLAELLQPHSTDDYRILVDMRWNKQYLDILANTCNFEDE 2605

  Fly  2688 SE----LNPLNLSA----LLLARLVVDIIPVSSVTTVQQMNALQYSQALCKKQVTEKYANH-LLA 2743
            ..    :..||..|    ||:.|.....|..:...:....:||:.:.:..|..|...:..| :|.
Zfish  2606 ERYMEFMEALNAVANRIMLLMDREERAAINSTDGNSTPHNSALRLATSFSKGTVDIGHLPHPVLV 2670

  Fly  2744 NFSSFLEVLHTSLLEDLETADLDLPQYA--HLVTRFHWFNRILATAQQKLLYNNELHVPL-MHKL 2805
            :..||.::..:.:|:.::|....:..:.  .::....|.:|..      |:.|:....|. :..|
Zfish  2671 HLRSFFDLWDSFILQAVQTGQPYISDHLMFEILQLLQWRDRFW------LVCNSLSADPRGVCVL 2729

  Fly  2806 VLHFQWLEKHLLVPLIEL--------------TAKSGCARMLTIQDRTLKIKKYIEET-RRP--- 2852
            .||:||:.|:|::.|.:|              |..:.....|:.........|.|::| .:|   
Zfish  2730 SLHWQWVHKNLILRLPQLLMGDSDYEGQQELHTISTAIQNSLSCSVAVASALKGIQKTLGKPLPF 2794

  Fly  2853 -----------LNVTCKIYSKQFTQFQPYYQDQQIQRHIELD---------DLEKLLSVVPSYGN 2897
                       |.|.|:...               .|.:.||         ::.:|..|.....:
Zfish  2795 KLETVAECAGRLRVLCRALD---------------VRDLRLDNSLASLWKQEVSRLRGVAMGIDS 2844

  Fly  2898 LELSSWLKRW-LLLQTDDANKWRSFLRKHTNGFQPKAFEISGSLRNETLQSHLQKLQTTLKEAQE 2961
            .|  :.|:.| |:||.:      ..|...|:|.                   |::|.:.:.:.|.
Zfish  2845 KE--ALLEAWGLVLQAN------LLLEPQTSGV-------------------LERLVSCVDQQQG 2882

  Fly  2962 NSAEIEMDLELDLNSIKTLLEAETEESESYIHPDGIPTNTPKLLIA-------ALREL------- 3012
            :.|..            .||::.:|:.|..:.....|.....|.:|       ||.||       
Zfish  2883 HMASC------------GLLDSLSEDEEDEVGDSAAPGREVLLQLARRAQLWPALEELAVLNQMK 2935

  Fly  3013 --------------------FMERLLTGTLRDDFDEQVNPLYADQLLTLNSNLWHCLKTLESANR 3057
                                .:.|..:..||  |..|..|:...||    ..||..|.|..... 
Zfish  2936 VTTDLLYLSVTSGGNKKAEESLRRSFSNHLR--FCMQSTPMNIRQL----QPLWFLLGTERPVE- 2993

  Fly  3058 TEITNAWIELKNEVNELQNYDEFAVLLEKIGGGYKG-LRSYQRQYRNSVQCYQLENLSTRLDCVQ 3121
             |:...|.||.:|.        .||:       :.| :.|...::.........||:::|  .:.
Zfish  2994 -ELPLVWCELLSET--------LAVM-------WSGSVTSDPERWLKWNPLNPEENINSR--SLL 3040

  Fly  3122 GPSEEGSTDISSQFCYRGPALSGVILSLIC----QPNGQ--LRS--VPLSELLEWRSALQQTRHL 3178
            |||:.|...:|.....|  ::.||:.|...    .|:|.  |.|  |.|.|..|....||....:
Zfish  3041 GPSDTGPGMLSRAVWSR--SILGVLSSTDTSGKWDPSGSHFLSSSRVTLGEWRERTGQLQDLSAV 3103

  Fly  3179 IWENS--------QLLTSRYSG--------EVNNLLQA------KENARQLLKELEYVRKLSEKE 3221
            ||:|.        :|...|..|        .::.||..      .|:...|.:..:.:|...|.:
Zfish  3104 IWDNMTMHELADFRLTDCRLQGLVLRKQLQSISELLSPGLQESYSESCDALTEGQDPIRAAHEIQ 3168

  Fly  3222 QKANQGF-ENCAKE--LEKMIEKLEKEENNNASMTKDFEVSLTNALV-----GAIELCLLTNTPL 3278
            ....:|. ||...|  ||.::..|.:..:|.:..:    :.|..:.|     |.:::.:.....:
Zfish  3169 IALREGLPENLLPEGFLETLVTCLTQFAHNRSQDS----IQLARSGVFWVNMGLLQIQVWAPQTI 3229

  Fly  3279 IDPVEKNRLKNEYIAEDIDCL----------STL---------TTAYDFMKIAMKYRHFGEEIYS 3324
            .||..|...|..|..|::..|          |.|         :|..:|....::|         
Zfish  3230 FDPAVKRAYKLRYAQEELALLQEEWRGRSLSSQLLTGAELEESSTTDNFQHPRIRY--------- 3285

  Fly  3325 ELELRLRTALQRQQQLSQKLALRSEKCLYASLVQDITHFLHSNGDCESLYKLFQLIHSEWENFQG 3389
             |.:|::...::..:||:|.|.|..:..|..|.|::.|:|.|.|...::..|..           
Zfish  3286 -LWIRMQQVKEQICELSRKQAYRPPEPQYGRLYQELQHYLCSIGQPAAVGDLLS----------- 3338

  Fly  3390 LHVATSAQL---KSSIEVLGKLD---LWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGL 3448
             |:..:.|.   ||.:.|.|.|.   :|.|:..||....|..: ..|.|.|.|::.::.|::.|:
Zfish  3339 -HLLKALQAPGPKSKLGVQGLLKEEAVWQASQHRFSQRLLEEF-PLYPDVVVPLRAAILQVQHGM 3401

  Fly  3449 ESL--KVIFTRVQQAGSVSQAEQMQQTIGDIVQFPSQHPLV---------------IRNSRLYGL 3496
            ..|  :|.|:...|.|.|       ..:..::.||.  |:.               :|..:..| 
Zfish  3402 RLLASQVSFSTTAQPGLV-------HLVSTMLTFPC--PVASSDLACADYLCSRECLRTLKTLG- 3456

  Fly  3497 LAELPHSEY------EYFRLLKAKLSELSNYIALGRVIDETTFAAYDDALSICNQTWQQEEHRRC 3555
             .:||.:|.      ....||.|.|...|:.::.|::..|..........:|.|: |.::|.|..
Zfish  3457 -KQLPATEVSRVIPDHAVLLLNALLYIQSHTLSAGQLSAEAQKLFRHVCQAIVNE-WDEQEKRAR 3519

  Fly  3556 QLKAEAESLYVTKTK--GGVDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQ--VLKLDKKAS 3616
            :.:....|||.::::  |...:|:..|.:|...:|| :..:|||:..|:|:|:|  :::.|..|.
Zfish  3520 EKEQMEASLYRSRSRLHGTGLTEDQQEEREFRRSFP-SYHKDFADITSEPSLDQPIIIEDDDDAD 3583

  Fly  3617 AKDKQSQIVVEEDYAFLARNFIDVMTRHTQV---------YYKEQPKSSKELELHLL-------A 3665
            .|.:.|     |..:.|..|...|:..|.::         |:.|.|.:..:..:..|       |
Zfish  3584 MKAESS-----ETSSLLISNMSRVVQVHQRLCLSFARSLWYHSEPPTNHAKDHISALVSSYQITA 3643

  Fly  3666 PYQARF------QVFANLHGHYKTALGSSLEERACNGL--AFGLALQQKQLRDIELEEGVSSSPY 3722
            |..|||      :|.:.|.|  ...|.|:|.:...:|.  :.||.||             :..||
Zfish  3644 PLIARFYHLMDCEVNSKLMG--SQLLLSTLLQNTVSGSGGSAGLILQ-------------NDGPY 3693

  Fly  3723 DFYKDSNISEIQSCLDVMERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQ 3787
            |||::.|:|:.:.||..:|::.|.|.::|..:|||..|..|.:||.||......:|:.:|..|.:
Zfish  3694 DFYREPNMSQARLCLPALEQLSKAVRQRLNDWPEHPALVQIIMVIERILAFSLSSPLAKFLNGLE 3758

  Fly  3788 LLRQKLALWNEVAHRNNNLVSEEIEVAEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYN 3852
            :|..|...|...|.|..:|.:|...|.:.:.:|.:|||..|.:.|.....:....:.::|..||.
Zfish  3759 ILLSKAQDWENNASRAVSLRNELEVVTQLIIQWRKLELNCWSSSLDNALKRHAENSTKHWLSIYQ 3823

  Fly  3853 LLQQFIHQKQLDHSYTDIKLAEQRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHI 3917
            |:::::.:::.:..:.|                    ..:.|.|:.|...|:.|:|.|..|:|.:
Zfish  3824 LIEKYLQEQKTNSRHDD--------------------GVENLSLSSVSSSLQAFIEGSTLGEFSV 3868

  Fly  3918 RLQLLQGFELYLHNVERAGKINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVK 3982
            ||.:|.||..:   :..|.|..|...|.:.|.||..|:|||:..|.......|||:||:||:|||
Zfish  3869 RLSMLLGFHCH---ILLAPKQEGHDSLCSLLWNLYKYYSQFSPSIQTKITHLRSPLEKELKDFVK 3930

  Fly  3983 IQSYSKDLSYFSMRNSVASVHRNLNKFLKEYRLSIQEKISE--VFQPKDSTAKDYTFGTDKGKGL 4045
            |..:: |:|::|:::||...||.|.||:|::..:::|..:.  |.|...|:..|.....::...|
Zfish  3931 ISKWN-DVSFWSIKHSVEKTHRTLFKFVKKFEAALKEPCAPCLVEQGSSSSMDDVDSQPEETPLL 3994

  Fly  4046 RNYNKIKYLHTERQQFVASEKLLEKFAIQEEFLSDN--TLLQRLDKHFRTARHVVKETLGQVPYG 4108
            |.:..:|.....:.:.:.::.       .||..|:|  :|..||....|..:.:..:.:.:....
Zfish  3995 RVHRALKEALPGKGRDLQADG-------PEELSSENPSSLQARLPVLTRKMKKLCVQLVKKTSLP 4052

  Fly  4109 ELITELDDLLASQLERCEHLRSLNVDRSKERPQQKQEAKQILQQKRKALTDLFKMLHRLGANYKT 4173
            ||..:||...|..:...:.|:.|.||||.|:.:||.|.|.|||||::||.||||||.::|.:|:.
Zfish  4053 ELSEDLDQFTAEIILNVQALQGLTVDRSMEQEKQKAEVKHILQQKQRALADLFKMLAQIGLSYRK 4117

  Fly  4174 GLLELSLRNEFEDFQLPPYSIRSMLP--RLHPTAQQL--------DEHLDLYYMKSVFKLKLLQN 4228
            ||......:..|...|.|..|:..|.  :.:..::|:        .|..:.|:.:|..:...|..
Zfish  4118 GLTWSRTADSDETVCLQPVEIKVALSAVKTNDNSEQMLFAEMTNAWEGCEKYFYRSWARRNALLT 4182

  Fly  4229 IMLTPLSELGPPNIERIKGFAVDLFLLVQQQREHLSGSTKELHELRNSLDSLRKLAEIIPQADIN 4293
            .:.:.:.|||..|:||.:||:..||.|:.:||..|:|.|:....||..:.|::.:.        :
Zfish  4183 ALQSAVKELGLGNVERCRGFSSHLFKLLLRQRRRLAGLTEHWVHLRKLISSVQSIQ--------S 4239

  Fly  4294 PSTLNFVKSADIA----MEIKQH-LRQ-----IH--YVLKQWKLLLSCAP-SSFIEESENR---- 4341
            ||:   ....|::    .:..|| :|:     :|  .||:|...||.|.| ||.:..:|.|    
Zfish  4240 PSS---ESGCDVSGVPPQDSLQHWIRRAQSSALHCSVVLQQISWLLQCCPESSSVAPAEAREGEA 4301

  Fly  4342 -----LLVRKISLAQSELHSLCI--------QILNSSQE-LLNELNN--ANLEYLSSEK------ 4384
                 .|.....||.......|:        :::....| |:.|:.:  ..|:.|:.|.      
Zfish  4302 MQGQATLSHPSPLAPHLQPQACLLRRGEQGWKVIEQKVESLIKEVKDLKMKLDGLAEESTERAIC 4366

  Fly  4385 -------CVTYQKSYAEIQENIKKTLELLRTGQNDYLPLAQP-IVELLDSVQLKNHTEIAPEAID 4441
                   |.:.....|.:...| ..||.|...::..:...|| ::..|.||:    ||:.....:
Zfish  4367 SWDHFTLCCSSLDRLAIVANQI-PALEQLFIPESVVILQTQPALIRGLQSVR----TEVETCLTE 4426

  Fly  4442 LANADTELANIAHS----------------------VLMSMQKIYKHHVKTDEVNQNGEAK-EQD 4483
            .....|:|.:|..|                      ||.::|.:.|...|..:.:|..|:| |.|
Zfish  4427 FTTWKTQLLSIRQSQKRHSHPFSVEFSGQLEKAINMVLCAVQTVVKRKEKEKQEDQLSESKRESD 4491

  Fly  4484 EE-SKEALQEQHLKKCLTGELTSDWQQLSLPRVLGKLSNVLLVLKHSHFEG------KDKLLCVR 4541
            .| .:|.|:..||.:.|..||:.|...||||.:.|.::.:|..|: ||.:.      ::.....|
Zfish  4492 SEVVEELLKPGHLSRLLEEELSGDLSSLSLPEINGVVTELLERLR-SHRDDCQPHHLQELREACR 4555

  Fly  4542 RAIGLLPVLEQYQLLADYLLLQQLATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQ 4606
            ..:.|.|:|..|..|..|.|...:..|:.:.|:||::..||.|:..||:|:|.:||...:|:...
Zfish  4556 SVVRLEPMLCLYSELVRYYLAVLMGAHRTTGKLLSVLANVFTELAQKGYCLPQELMGGGDGEGAT 4620

  Fly  4607 ESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRPEDRKDEGDKQEPDCKEE-KGIEMSDDFDAK 4670
            |..:.||.|:.:|.|..|.|||||:|||::|..:....|||.::.:.|.||| ..||||:|||.|
Zfish  4621 EFHDYEGGGIGEGEGVKDVSDKIENEDQVEDTFQEGKDKDEEEQDKQDIKEEDNAIEMSEDFDGK 4685

  Fly  4671 MQD--VEKPEEDDSGESEEEEDLNKEMGETEEG-AEKLDDQIWGDDEEEK-------PEEEQEPD 4725
            |.|  ..:|.||:....:|:|:|:|:||:..:| .:.||:::||||::::       .|||..|.
Zfish  4686 MHDGTDREPGEDEEDSDKEDEELDKKMGDLGDGQTDTLDERMWGDDDDDEDNNDDSDKEEESGPG 4750

  Fly  4726 MNEEDQGKGSKDEKDAHNDLDTKNDAAKEDGKDEHEKDGLDATNEPSGEDKRKEQAKDIDDMKDP 4790
            |   |||:.....||.:.|       |.|..||:::...|     |..|:::::..:.:|:.   
Zfish  4751 M---DQGESELVAKDDNTD-------AGESNKDKNQDKDL-----PKDEEEKEKIHEQVDER--- 4797

  Fly  4791 EMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDE-GHDDQDEQPTDENPFDIDAMKENMQPAEEPE 4854
            |.||.:.:..|.:.|:..|||.|:|.:..|:|| |.|::.|:..:|||||||.     :..|..|
Zfish  4798 EFDENEVDPYHGKQEKKAEPEAMELPEELNLDEDGKDEEGEEANEENPFDIDD-----KLMEVDE 4857

  Fly  4855 ADGDDEHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDED 4919
            ..|:|:.:..|.||..:|    |:.:.|.|.:..|||:.|.:|...:.|..:.|..:|||.|:||
Zfish  4858 KTGEDKGEPEEGGDEMTD----EQQQEGQEEEHGEEDNTEEKEEAEKSEDQDPEMDERGENEEED 4918

  Fly  4920 DSK----------------PED-SPEDSKEEKEEKREEKPEEHSQSKDKASK----EENVQSMPE 4963
            |:|                |.| ..|..|||..::.:|.|.:.::.|:.||.    ||||||...
Zfish  4919 DNKEKNKGQEEGREEDKSIPADQGQEPKKEEDGDEDDEAPLDSAERKEHASDGQTGEENVQSDTA 4983

  Fly  4964 TDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKN 5028
            .:.:.:|                 .|::..:|:||.|.|:....: ||......:.:..::.:||
Zfish  4984 VELAGAA-----------------SEKDQAKEEDGSGAADASQSE-GHDSKLMARMSSQKQRQKN 5030

  Fly  5029 ERQTQE-KRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMDQTEAEEYQHV 5092
               ||. |||.|:.:.|||:|:..:...|:|:|:|      :::...|::.:|..|.|::.|:|:
Zfish  5031 ---TQSFKRKPGQADNERSMGDYNERVNKRLRTVD------KTEQKTQDQTQPDTQQESDLYEHI 5086

  Fly  5093 KE-PKNSDKTTLDNATEEQSKKIQHQEDEPPNEEEI--EAENVDELMEAEEPAVDPE--DDAELE 5152
            |: .:..|..|.|.|::||.|....:::|...|::|  |.|...:|...|...:.||  :|.:..
Zfish  5087 KQGDERYDAQTYDVASKEQQKPTGVKQEEEDEEDDIAMEVEEEKDLQAVEAQELKPEKLNDNKAS 5151

  Fly  5153 QLGAEKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETTAHSNSEILLDKSSHAE 5217
            |.|.:..:.::.|.: .|:..|:|||...:. |.|:     ..||.|:|.|:..|:|::  :...
Zfish  5152 QKGLDCGDLEAQKQA-IEEEMEKLETQRSIN-EEEM-----KERSDESTIHTVPELLME--TQKA 5207

  Fly  5218 DLSSAEQIELRQQYQKQLTTF-RVAQPEHED-------YETWQGISNRMTQNARELCEQLRLILE 5274
            .|.:.|  |||::.:.||..: |.....||:       :..:|.:::.::|   :|||||||:||
Zfish  5208 TLMNPE--ELRREMELQLEAWQRQTLGSHEEESAAAALWHQYQTLTSPLSQ---QLCEQLRLVLE 5267

  Fly  5275 PTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKSMHHNNSK 5339
            ||:..:|:||:|||:|:||:|:||||||||||||||||||||::|:|:|.:|:|||.||..|::|
Zfish  5268 PTQAAKLRGDFRTGKRLNMRKVIPYIASQFRKDKIWLRRTKPSKRNYQICLAVDDSSSMVDNHTK 5332

  Fly  5340 TLTLEAISLVSQALTLLESGRLSIVSFGEAPQIILNHTEQFD---GPRLVNALNFAQDKTKIAGL 5401
            .|..||:|::..||||||.|::|:.||||..|::....:||:   |.:::....|.|.||:||  
Zfish  5333 QLAFEAVSVIVNALTLLEVGQVSVCSFGETVQLLHPFHQQFNDQTGAKILRLCQFQQKKTRIA-- 5395

  Fly  5402 LNFIRTAN-----AEESGTGGDNGLFENLLLILSDGRNIFSEGAQNVKNAIKLARLQRIFLVYII 5461
             .|:.|:.     |::...|..|.....||||:||||.:|.||.:.|..|::.||...:|:::::
Zfish  5396 -QFLETSTNMFMAAKQQIPGATNTETSQLLLIVSDGRGLFLEGKERVATAVQAARSANVFVIFVV 5459

  Fly  5462 IDNPDNKNSILDIQHVAVNADGSV-NINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELVNS 5525
            :|||::::|||||:.......|.: .|.||::.||||:|||:|::|.||..||:|:|||||||.:
Zfish  5460 LDNPNSRDSILDIKVPIFKGPGELPEIRSYMEEFPFPFYVILRNVNGLPETLSDALRQWFELVTA 5524

  Fly  5526  5525
            Zfish  5525  5524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1836/5722 (32%)
P-loop_NTPase 315..505 CDD:304359 76/192 (40%)
P-loop_NTPase <887..972 CDD:304359 56/86 (65%)
P-loop_NTPase 1147..1283 CDD:304359 103/136 (76%)
P-loop_NTPase 1454..1603 CDD:304359 93/157 (59%)
P-loop_NTPase 1795..1946 CDD:304359 94/152 (62%)
P-loop_NTPase <2335..>2378 CDD:304359 21/43 (49%)
Prothymosin 4843..4920 CDD:281265 24/77 (31%)
PHA03151 4856..5060 CDD:177546 64/226 (28%)
MttA_Hcf106 <5046..5166 CDD:294511 33/125 (26%)
vWA_midasin 5261..5526 CDD:238737 132/275 (48%)
mdn1XP_003200751.2 P-loop_NTPase 311..440 CDD:304359 75/183 (41%)
P-loop_NTPase 633..>674 CDD:304359 27/41 (66%)
P-loop_NTPase <796..883 CDD:304359 56/87 (64%)
AAA 1058..1196 CDD:214640 104/138 (75%)
P-loop_NTPase 1059..1195 CDD:304359 103/136 (76%)
P-loop_NTPase 1339..>1388 CDD:304359 29/52 (56%)
AAA 1363..1517 CDD:214640 94/159 (59%)
AAA_5 1365..1517 CDD:285029 93/157 (59%)
MoxR 1726..>1894 CDD:223786 107/180 (59%)
P-loop_NTPase 1738..1878 CDD:304359 94/152 (62%)
P-loop_NTPase 2052..>2096 CDD:304359 14/44 (32%)
P-loop_NTPase 2162..2297 CDD:304359 54/138 (39%)
vWA_midasin 5254..5525 CDD:238737 133/278 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354804228
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H39689
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D138219at2759
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R702
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.