DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and c12.2

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001259381.1 Gene:c12.2 FlyBaseID:FBgn0040234 Length:1403 Species:Drosophila melanogaster

Alignment Length:1429 Identity:275/1430 (19%)
Similarity:488/1430 (34%) Gaps:439/1430 (31%)


  Fly  1366 EEGYLVL---SSKVRSQEEHELIEKTL--FANFRKKLDLQTLFDIQTDRESSSMVSRKILDAIRN 1425
            ||..|.:   |.::|..::.:|:.:..  .:..::..||:...:::...:.:..:|:..|..:| 
  Fly    38 EEDSLTIGDVSVRLRKPKDPQLVPQQYADTSRIKETTDLKRRNELKYASDGTLQLSQSALHHLR- 101

  Fly  1426 FKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTE 1490
                    |        ::...||..|  :.|:|..|..:..:......:...::..:.....|.
  Fly   102 --------W--------MLQKDALRQD--MFLLGQPGPLRRQLAMQFLELTQREVEYVALSRDTT 148

  Fly  1491 GADFLGGLRPCRGKESTQLFEWA----DGPLIYAMQEGSYFMADEISLAEDSVLERLNCILE--- 1548
            .:|.         |:..::.:.|    |...:.|...|...:.|.:..||.:||..||.:||   
  Fly   149 ESDL---------KQRREINDRAAIFHDQGAVRAALNGRVLVLDGVEHAERNVLPILNNLLENRE 204

  Fly  1549 -----------PERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELSPALRNR 1602
                       |||...|.||....:||...  :::....|:.:|...|...:....|.|.||:|
  Fly   205 MHLESGKFLMSPERYDKLLEKHSREQLDEWG--LLRVSEQFRVVALGLPTHKYKGTPLDPPLRSR 267

  Fly  1603 FTEVWCLPSDNKEDLIEIAYNCMRRQKEHENQAINTHKVAEYL--------VDVVLHIRDTNDKF 1659
            |         ...::...:|..:..:.:.|..::...::.:.|        .|.||.:.|     
  Fly   268 F---------QSRNVTTYSYGELYEELQQEAPSVPGEQLKQLLTFALTLQQADPVLQLPD----- 318

  Fly  1660 KFSVRDILAWANYMVSNAKLSFAE--QAIFGLETIFLDALEMLPHESQEQVELLKSNIVKQAIKQ 1722
             |.:.::......:.:|..||..:  ..|:..:|       ||..:.:::||.|...:..|.:..
  Fly   319 -FPIHNLALGVKMLAANPSLSLHDVISRIYPYQT-------MLKPDQKKRVEELLKKLDIQLVPS 375

  Fly  1723 ASLILQEKFTLEELSEKRGTEVELNECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLFRLL 1787
            .|:    |....:..|.....::|:|.:       :::.:.::.:|...|: |.|..:|.|..||
  Fly   376 PSI----KKIEAQSQENSLIHIKLDELQ-------LNLPEGQIPTASTYFV-DLPHQRQALASLL 428

  Fly  1788 SALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTA 1852
            .|.:: ..|.|.|..||||.::.:.:          :.|.:.|....:...|:.:.|        
  Fly   429 QAYAV-GDVCLVGEKGVGKLTLTQEL----------LRLLQQTSEPMMLYEDMTSRD-------- 474

  Fly  1853 ATERQIRS----FVWRDGPLLAALKA-------------KNTWILLD------ELNLAPQSVLEG 1894
            ..:::|.|    .||||.||:.|.|:             |:|..:|.      ||.|...:.|.|
  Fly   475 IVQQRITSPQGDTVWRDSPLVRAAKSGSVAVLNGLHRLHKSTASVLQRLIHDRELQLCDGTTLLG 539

  Fly  1895 LN---AVL------DHRGEVYIPELNKSFHLAGSTRIFACQNPLKQGGGRKGLPQSFLNRFTKVY 1950
            .|   |:|      :..|::....:::||      |:.|...|.:.|||:    .|:|       
  Fly   540 ANRYQALLQQGFSKEELGKLGFLPIHESF------RVVALAEPPRLGGGQ----PSWL------- 587

  Fly  1951 LRKLSTEDLLHVVTEKYGKYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRF 2015
                 |.:||                            :|| :|.......:|:..:|.|:|.  
  Fly   588 -----TPELL----------------------------SLF-LYQELRPLRQSEEAELLAQLC-- 616

  Fly  2016 SEQLDRGVASMEFGYKGGPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERM 2080
                            ||.....:..:|:...||.:.|...:.|.:.            ||..|.
  Fly   617 ----------------GGDLPAGMDQLLKLAQLLRSSQDPLLQGLAG------------TLSTRQ 653

  Fly  2081 QLVYYQRMRC--DQDKSYIRNVFSTVFLCDAEYLNQVSNDVALYWTADKVYL--NDVVLSRKQAD 2141
            .|...:|:..  :.:.|.:..:....||  |.::..:|.. ||.....:|.:  .::.|..|:..
  Fly   654 LLKLARRLAAYPESELSDVHEMLQNTFL--ARFMPALSRG-ALEQAIQQVGIKPREIKLKSKKNQ 715

  Fly  2142 VLDLVNRQEQSPLLLDSQR--------QQLKQIIETVHMEKP------------------LLLCG 2180
            :     ..|.:.|.:.|.|        .||.::..|:..|.|                  |||.|
  Fly   716 I-----AVEDNSLRIGSTRWPLGNPTQAQLSKVPHTLFYEMPQHVQLLERLLQDYLIGEHLLLVG 775

  Fly  2181 STDSGKTKLIDALCVLSNRLCNTDIIDDSVTGSFQQIDLNRHLEIIYKKVETLVFSCVQRAF--- 2242
            :...||.||:|.|..|..|             ..:.|.|:|         :|.|.|...:|.   
  Fly   776 NQGVGKNKLVDRLLELMQR-------------PREYIQLHR---------DTTVHSLTLQATLKD 818

  Fly  2243 --VLHTQSEFVEQLWNNWSMYNKLAKVTTEAQQHSV-----------LDELKLFSERL----GSL 2290
              |.:..|..|:.:.....:      |..||.:..|           ..|:.|...|.    |..
  Fly   819 GQVSYEDSALVQAVRTGHVL------VVDEADKAPVNVTCILRTLVESGEMVLADGRRIVPPGEG 877

  Fly  2291 GKIIEVLEATPQ----------------NCQVRALQQL--------AEIKSQLLLLQTY-----I 2326
            |::...:|..|.                |....||..:        .:.:|::.|||.|     |
  Fly   878 GRVPNSIETHPDFRLIVLANRPGFPFLGNDFFAALGDVFSCHAISNPDPESEIFLLQQYGPKVPI 942

  Fly  2327 KTADSL-NTGG-----------SFEWVDSQIVTSLKCGQYILLEHVNLCSSAVL--DRLNP---- 2373
            ||..:| |..|           ::.:...::|:.:|..:....|:::.....||  ||..|    
  Fly   943 KTLRTLVNAFGELRTLADEGMLNYPYSTREVVSIVKHLERYPEENMSEVVGNVLDFDRYQPEALQ 1007

  Fly  2374 ----VFEPNGSLLIAEKGISAQDSAEVVYKSTNFRAFLTVD-PKNGELS-----RAMRNRCVELS 2428
                |...:|....||:.|.|.....::..|.|..:.|.|. ||.|:|.     ....|.....|
  Fly  1008 QVTQVLAKHGIESYAEEEIQAIRKQRILQASVNRHSGLGVSGPKFGKLDPKNEPHVGGNTWAGGS 1072

  Fly  2429 LSRDTYSV-------------------DDLRAFVHEQ---GVREM---------EAIDCILRVHK 2462
            ..|||..:                   |:.:|.|.|:   ..|||         :.|......||
  Fly  1073 GGRDTAGLGGKGGPFRLDKGHKVHQLSDEEKADVPEEIKRAAREMNRKAFEDKLKEIKMSAHDHK 1137

  Fly  2463 GLSQLTEFNNYSISHLTQFAFLSAAYRRI---------------------GYELKRAIYVAAMEV 2506
            ..:|.:|.|...:..|.  |.|.|...:.                     |...::.||....|.
  Fly  1138 LYAQFSEPNRKQVQQLK--AVLEAMQTKSKERQWQKYQTHGDLDDTRLVEGITGEKNIYRRRAEA 1200

  Fly  2507 YVYSAN-----------TDLMG--YGLSYYQNKLREVVLAQTEVFEEVAVIQEDFLSDVILNSG 2557
            ..::.:           .|:.|  |..:.|..:|...:.|...|.|.....::..:.|:|.:||
  Fly  1201 NPWADHVQEKPNRLKLVVDVSGSMYRFNGYDGRLDRQLEAVVMVMEAFEGFEKKIVYDIIGHSG 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 275/1430 (19%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359 35/167 (21%)
P-loop_NTPase 1795..1946 CDD:304359 43/183 (23%)
P-loop_NTPase <2335..>2378 CDD:304359 10/64 (16%)
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
c12.2NP_001259381.1 AAA_5 112..268 CDD:285029 36/169 (21%)
AAA_5 435..595 CDD:285029 47/228 (21%)
AAA_5 770..916 CDD:285029 36/174 (21%)
vWA_F11C1-5a_type 1212..1403 CDD:238732 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.