DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and Cp190

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_524359.2 Gene:Cp190 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster

Alignment Length:1220 Identity:240/1221 (20%)
Similarity:429/1221 (35%) Gaps:318/1221 (26%)


  Fly  3975 KKLKEFVKIQSYSKDLSYFSMRNSVASVHRNLNKFLKEYRLSIQEKISEVFQPKDSTAKDYTFGT 4039
            :||:.|.....|. ||:.....||...|||.:.....:| .::.|:..|:..  |:......|..
  Fly    18 QKLQNFFNKTDYC-DLTLQFRDNSQLKVHRLVLSACTDY-FNVLEQTCEIVD--DALIMPNEFQA 78

  Fly  4040 DKGKGLRNYNKIKYLHTERQQFVASEKLLEKFAIQEEFLSDNTLLQRLDKHFRTARHVVKETLGQ 4104
            |....:     :.:::|...:|  ..|:..|.....:.::...||:.|:.|.||..:|.::....
  Fly    79 DVVVPI-----VNFMYTGTLEF--ELKMYGKLLRTAKEMNMTVLLKLLEAHRRTMENVNRQQRPP 136

  Fly  4105 VPYGELITELDDLLASQLERCEHLRSLNVDR-SKERPQQKQEAKQIL---QQKRKALTDLFKMLH 4165
            .|.|                   :|...|.: |...|||:     :|   .|.|...|.:.:.  
  Fly   137 SPKG-------------------IRRRTVGQPSSGLPQQR-----VLGPSPQSRNVATPIAQR-- 175

  Fly  4166 RLGANYKTGLLELSLRNEFEDFQLPPYSIRSMLPRLHPTAQQLDEHLDLYYMKSVFKLKLLQNIM 4230
               ||.:.|....::..........||...|.: :..||:.  .|.|...|..:   .:..|..:
  Fly   176 ---ANTQRGSTGNTMSRTSGGSNRSPYGDSSNV-KQEPTSP--FEQLRKGYNNN---KRPAQTSL 231

  Fly  4231 LTPLSELGPPNIERIKGFAVDLFLLVQQQR--------------EHLSGST-KELHELRNSLDSL 4280
            |:|.|:  .|::|.:|.||       :|||              |:..|.. .::|...:..|  
  Fly   232 LSPPSK--KPSLEEVKEFA-------EQQRMRKQIAAEYGDNDPEYDGGMLYDDVHAGDDDDD-- 285

  Fly  4281 RKLAEIIPQADINPSTLNFVKSADIAMEIKQHLRQIHYVLKQWKLLLSCAPSSFIEESENRLLVR 4345
                ::.||    |||...........:::.....|  :|||..  .|..|:..:::|.|     
  Fly   286 ----DMPPQ----PSTSKQQSPQGTQTQLEHGSTTI--ILKQDS--PSQTPTIIVKDSSN----- 333

  Fly  4346 KISLAQSELHSLCIQILNSSQELLNELNNANLEYLSSEKCVTYQKSYAEIQENIKKTLELLRTGQ 4410
                |:.....:..::|.....::....|..|:.:.:......:||          ....::...
  Fly   334 ----AKLNHTKIIAEVLRQYPHIVKGHKNIKLKIMPNTPAAPTEKS----------APATVKPPA 384

  Fly  4411 NDYLPLAQPIVELLDSVQLKNHTEIAPEAIDLANADTELANIAHSVLMSMQKIYKHHVKTDEVNQ 4475
            |.......|..:|  .|..|            |:..|.|.........|.||     ..|.:...
  Fly   385 NQSSATTSPHKKL--HVSFK------------ADKSTPLITAQQKAASSQQK-----SGTSQTTG 430

  Fly  4476 N-------------GEAKEQDEESKEALQEQHLKKCLTGELTSDW---------QQLSLPRVLGK 4518
            |             .:.:..|.::..||..|..:     ..|..|         :.:|:|...|.
  Fly   431 NQGTGANPPANTAAAQKRRIDSKTMHALIAQGAE-----NTTGPWLCLRCGVNGRPISIPSYRGF 490

  Fly  4519 LSNVLLVLKHSHFEGKDKLLCV--------RRAIGLLPVLEQY--QLL---ADYLLLQQLATHKV 4570
            ..:::    ::|.|..|..||.        .|.:.....:|..  .||   |:..|..|  :::.
  Fly   491 RRHLI----NTHKETIDPALCEHCGWRSVNNRELHFHMYMEHQTKSLLYTFAECALCNQ--SYRT 549

  Fly  4571 SAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKN-GEGFGLEDGTGENDASDKIESEDQ 4634
            ..::.:.:..|..: .:|..|:..:.:.::|.|..:..|: .:...||||..:....:.:.|:|:
  Fly   550 KGELEAHINEVHTD-DNKQQCIYCNKVFEQELQLYRHMKSYHKEQALEDGIIDETDEEFLGSQDE 613

  Fly  4635 LDDAKRPEDRKDEGD-KQEPDCKEEKG-----------------IEMSDDFDAKMQDVEKPEED- 4680
            .::|        ||| :|||   |:.|                 ::.:.....:.:|||:.::: 
  Fly   614 EEEA--------EGDEEQEP---EQTGKVRILSDISLPATSAITVQQAQQEQLQEEDVEQVQQEV 667

  Fly  4681 -----DSGESEEEEDLNKEM----------------------GETEEGAEKLDDQIWGDDEEEKP 4718
                 |..|.|..::..||:                      .|.|...::.|::.....|||..
  Fly   668 KFVGADGNEVELTDEQRKEILSQLNQQQAGATAGGVVMVLSEPEAEHVKQETDEKSLAGTEEEYD 732

  Fly  4719 EEE-----------QEPDMNEEDQGKGSKDEKDAHNDL--DTKNDAAKEDGKDEHEKDGLDATNE 4770
            :.:           :....|..|:.|.|.|..:...:|  :::..:.||...|:...|..:...|
  Fly   733 DSQIYSELGAADSVESAKKNIADESKESIDNLEWAENLIAESEEQSNKEPKSDKPRDDISEKLKE 797

  Fly  4771 PSGEDKRKEQAKDIDDM------------KDPE--MDEEQTN------AMHNELEEPPEPEEMDL 4815
            .:|:....|...|:||.            ||||  :.||:.:      ::|...||..| |:...
  Fly   798 LTGDWTEDENDDDVDDKPATAELASELANKDPEPTVHEEEDDIDLALQSLHKGPEEATE-EKASE 861

  Fly  4816 GDMNNVDEGHD------------DQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEEGD 4868
            ..:.:.|:..|            |.|.:..||.     |.|..:|..:|.|.:.|.|....|:..
  Fly   862 ESVTSADDAVDAVPNINSQPEKMDVDSEAADEK-----ASKAEVQIKKEAELENDQEEFIKEDSP 921

  Fly  4869 -PQSDGSDSEEDEAGTEAKPAEEDHGE-------------GEEATPEDEKDEAETQKRGELE--- 4916
             |.|| |.:|..||.|.::..::.|.|             .|...|:.|||..::::....|   
  Fly   922 IPHSD-SVAELREAVTASEGEDDVHLEADNIRKELLDELIAEAEKPDQEKDIVQSEENATTEALD 985

  Fly  4917 ----DEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQ 4977
                ||||..|.......:.|.:|...||..|:::....|.::|.|:..|...|     .|...:
  Fly   986 RSVTDEDDLVPPTQVSTEQMEIDEPAAEKAAENNEDTRTADEKEAVEDKPNQTQ-----DVTTAE 1045

  Fly  4978 DPDIKQDQKLDEQETGE--EKDGV-------GQAENDADDGGHQGVAETQ 5018
            .|.::..:..||..:||  ..|.|       |..:.|.|:.|....|:.:
  Fly  1046 KPTLESAKAGDEATSGEAASVDKVKSLISEWGDDDEDEDENGVSAAAKEE 1095

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 240/1221 (20%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 26/98 (27%)
PHA03151 4856..5060 CDD:177546 47/194 (24%)
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
Cp190NP_524359.2 BTB 20..122 CDD:279045 23/113 (20%)
BTB 31..127 CDD:197585 23/106 (22%)
C2H2 Zn finger 540..568 CDD:275371 4/31 (13%)
C2H2 Zn finger 569..586 CDD:275371 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117239287
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.