DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and CG12592

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_731474.1 Gene:CG12592 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster

Alignment Length:673 Identity:130/674 (19%)
Similarity:249/674 (37%) Gaps:172/674 (26%)


  Fly  4656 KEEKGIEMSDDFDAKMQDVEKPEEDDSGESEEEEDLNKEMGETEEGAEKLDDQIWGDDEEEKPEE 4720
            ::|....:|....:|.::..|.:......|:..|:|.:..........||:.......:::...:
  Fly    16 QDELSSSLSSSVASKFKEFSKRKRISDSFSDLSEELERIGLRQMRKRIKLEKSFERTPKKKVQTK 80

  Fly  4721 EQEPDMNEEDQGK------GSKDEKDAHNDLDTKNDAAKEDGKDEHEKDGLDATNEPSGEDKRKE 4779
            :..|.:.::|..|      .|..:::....:.|.:|::  :.|.|..|   :.:|..|...|..|
  Fly    81 KHLPPVRKKDSVKRRRIIIASPSDEEHDGKVQTNDDSS--ENKTEKPK---NQSNCSSNASKLSE 140

  Fly  4780 QAKDIDDMKDPEMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMK 4844
            .|:.::      :.||:::....|||   ...::.|.::|..:..:       ..|...||..| 
  Fly   141 AAQLLN------VSEEKSSISETELE---RSRQVALNELNKSERFN-------KTETQLDISVM- 188

  Fly  4845 ENMQPAEEPEADGDDEHDANEEGDP-------------QSDGSDSEEDEAGTEAKPAE-EDHGEG 4895
                     |.|..| ||..|:.:.             .||..:.::.:....||||| |:|.|.
  Fly   189 ---------EVDSSD-HDEEEKTEKVGAKNNRSLYEIVDSDDEEEQDQDQSDAAKPAESENHSEI 243

  Fly  4896 EEATPEDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQS-KDKASKEENVQ 4959
            :::|...::.......:...|..|..:.||..|..|.|:.:|  :||.|:.:| |||.::.|   
  Fly   244 KKSTSFMDQMSGAKGNKSVYEIMDSYETEDPKEAGKNEESDK--DKPAENGKSDKDKQAETE--- 303

  Fly  4960 SMPETDQSSSADQVQQPQDPDIKQD--QKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVS 5022
             |.:.|:.|   :::.|.  .||:.  ...||:..        .||..:.|..|      .|.:.
  Fly   304 -MSDEDKPS---EIKSPS--TIKKSIISTADEEAL--------LAELASSDLSH------LEKMF 348

  Fly  5023 QEDRKNERQT---------QEKRKQGRTNEERSLG----------------EAEQNKLKQLKTID 5062
            ...:|:.||:         .:..|..|.:|...:|                :.::||.|:|    
  Fly   349 NPLQKSRRQSLHVPSPELAAKNPKLRRRSERVEVGNDFCPSQSFVDMVAEKKRQKNKRKRL---- 409

  Fly  5063 QLKDSKESDDAEQEKPEPMDQTEAE-EYQHVKEP--KNSDKTTLDNATEEQSKKIQHQEDEPPNE 5124
                ||....|    ||.:::.|.: |.:.:|..  .::|....||..|..:...:|..|...:.
  Fly   410 ----SKSLSGA----PEDLEEMEIKHERKRLKSSHGASTDSMEEDNENETMTVAEEHHSDGEVSN 466

  Fly  5125 EEIEAENVDELMEAEEPAVDPEDDAELEQLGAEKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVV 5189
            .|:..|                          ||....|:|||.:|..:|....|..::.:    
  Fly   467 GEVPIE--------------------------EKPTTSSEKPSASELPEEGNSAPPALKKD---- 501

  Fly  5190 LTMTVPRSSETTAHSNSEILLDKSSHAE---------------DLSSAEQIELRQQYQKQLTTFR 5239
             ...:..:.:..:|:.:.:...|::.||               |..||:|.:..::.||......
  Fly   502 -VKRLQAARQAVSHAVNLLAPPKATEAEPRTLSRKLSPQPPVVDKKSAKQKKKGKKKQKPQEASP 565

  Fly  5240 VAQPEHEDYETWQGISNRMTQNA 5262
            :...:.|::      .:|:..||
  Fly   566 LKSSDEENH------GHRIRTNA 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 130/674 (19%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 20/91 (22%)
PHA03151 4856..5060 CDD:177546 56/246 (23%)
MttA_Hcf106 <5046..5166 CDD:294511 25/139 (18%)
vWA_midasin 5261..5526 CDD:238737 2/3 (67%)
CG12592NP_731474.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117239306
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.