DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and stm

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_942112.2 Gene:stm ZFINID:ZDB-GENE-031112-4 Length:613 Species:Danio rerio

Alignment Length:610 Identity:144/611 (24%)
Similarity:256/611 (42%) Gaps:93/611 (15%)


  Fly  4613 GFGLEDGTGENDASDKIES-EDQLD--------DAKRPEDRKDEGDKQEPDCKE--EKGIEMSDD 4666
            |..:......|:.:|..|| .||..        ....|.|    ||....|.|:  ||.....|.
Zfish    16 GVSISAPVSNNNGTDNDESAADQRHIFTVQFNVGTPAPAD----GDSVTTDGKDSAEKNEAPGDS 76

  Fly  4667 FDAKMQDVEKPEEDDSGESEEE-------EDLNKEMGETEEGAEKLDDQIWGDDEEEKPEEEQEP 4724
            .|.    .|||...|..:|.|:       :|..::.|.|.:|.:..:.:...|...:||:.:...
Zfish    77 SDT----TEKPGTTDGKDSAEQHGVTTDGKDEAEQHGVTTDGQDSAEKRGEADGAPDKPDTQNGT 137

  Fly  4725 DMNEEDQGKGSKDEKDAHNDLDTKNDAAKED-------GKDEHE-KDGLDATNEPSGEDKRKEQA 4781
            |..:.||...:...|...:| :.|:..:.||       |||..: |:..|.|::|.|.|  .:.|
Zfish   138 DDTDSDQETDASHHKTGDSD-ENKDKPSAEDHTDGNHAGKDSTDSKESPDTTDKPEGPD--SDSA 199

  Fly  4782 KDIDDMKDPEMD-----EEQTNAMHNELEEPPEPEEMDLGDMNNVDEGHD----DQDEQPTDENP 4837
            .|.|.....:.|     :|..|....|.::....::    |.:..||.||    |:||:..|:: 
Zfish   200 PDGDSASAEKTDSDHSPDEDANKSSTEADKDDTSDK----DSSQTDEKHDSDASDKDEKHEDKD- 259

  Fly  4838 FDIDAMKENMQPAEEPEADGDDEHDANEEGDPQSDGSDSEEDE--AGTEAKPAEEDHGEGEEATP 4900
                      :.::|.::..|.|..:.|:.|...|||:||.||  ...|:|    ||....:.:.
Zfish   260 ----------EKSDEKDSSKDSEDKSQEKSDKSDDGSNSEADEQKESVESK----DHDSDSQDSD 310

  Fly  4901 EDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQ--SKDKASKEENVQSMPE 4963
            ..||.|....|..:..|..|||  ||.||..::..|:::.:..||.:  :|||...:::.:...:
Zfish   311 SAEKKEKHDDKDQDSSDSADSK--DSDEDKDKDHSEQKDSEDHEHKEKHTKDKEEHKDSDEGKDD 373

  Fly  4964 TDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAEN-------DADDGGHQGVAETQETV 5021
            .|:|.|.:  ....:.:.|:..|.||.|..|:||....::|       |:|...|........:.
Zfish   374 EDKSKSDE--HDKDESESKEASKSDESEQEEKKDDKSDSDNSSRDSHSDSDSDSHSDSDSDSHSD 436

  Fly  5022 SQEDRKNERQTQEKRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMDQTEA 5086
            |..|..::..:.........::..|..:::.|...:.:..|:..:|::.|.::.:.....:.:|.
Zfish   437 SHSDSDSDSHSDSDSDSDSDSDSDSDSDSDSNSRDKDEKKDKSSESRDEDSSDSDSKSNSESSET 501

  Fly  5087 EEYQHVKEPKNS----DKT-TLDNATEEQSKKIQHQEDE----PPNEEEIEAENVDELMEAEEPA 5142
            .| :...:.|:|    ||| :.|:|:.|.:......:|:    .|:.|:..||..||  ::.:.:
Zfish   502 AE-EDTNDDKDSSVEKDKTDSSDSASVEANDSDDEHDDDSKDATPSSEDHTAEKTDE--DSHDVS 563

  Fly  5143 VDPED-DAELEQLGAEKTEQKSDKP 5166
            .|.:| ||..::.|.|....::.||
Zfish   564 DDDDDIDAHDDEAGVEHGTDEASKP 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 144/611 (24%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 21/79 (27%)
PHA03151 4856..5060 CDD:177546 52/215 (24%)
MttA_Hcf106 <5046..5166 CDD:294511 29/130 (22%)
vWA_midasin 5261..5526 CDD:238737
stmNP_942112.2 PHA02664 <163..298 CDD:177447 39/152 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.