DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and Mdn1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_017458400.1 Gene:Mdn1 RGDID:1306394 Length:5595 Species:Rattus norvegicus

Alignment Length:6124 Identity:1925/6125 (31%)
Similarity:2944/6125 (48%) Gaps:1159/6125 (19%)


  Fly    16 LELTANESEDNVFSQSLQKFIKKQKYVPQDVERLFRSLSEQLPLPAYTVPIAASFEEQLLLLL-- 78
            |.|.|.::|.:  |..|.:|:.|..:.|||.:.:..||::.|....||:.:.......||.||  
  Rat    13 LRLIATKNEKS--SGELNRFLAKSVWTPQDRQCILNSLAQLLLDKDYTLLLGRQLRPILLDLLER 75

  Fly    79 -SMALRWDSASQRFH-TYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEK--QQSNGSLPSKK 139
             :.|::  :..|..| .::...|::|||:....|...||..||.|....|::  .:|:.:.|.:.
  Rat    76 NAKAIK--TGGQVNHDLHERLSVSMSKLIGSHPDVLPFALRYFKDTYPVFQRLFLESSDANPVRY 138

  Fly   140 SKNGNHAADNLDDLELIKCCFQLLKSDTPYFRELWDWS----------SFIATYTHNSSSPKTQL 194
            .:......|      |::.....|:...|.||||||||          :.:..:|.|        
  Rat   139 GRRRMKLRD------LMEAAHIFLQHKQPVFRELWDWSVCVPLLRSHDALVRWHTAN-------- 189

  Fly   195 YCNYIVAMLTNMSAPQLNSLNEKISTKTRLEFDQER---EQAWNTARNTLCSYTPDAS------- 249
             |   :|::|.|:.....|...||.:...|...:.|   |.........|....|:||       
  Rat   190 -C---LALVTCMNEEHKLSFLRKIFSSEELVHFRLRLLEEAQLQDLEKALVLANPEASLWHKGEE 250

  Fly   250 DQLLNLHL--HGINKSVTNIEGVLLPTFNEENLEFYASTDGCYDR------------IVKVDSTV 300
            .|.:..||  ..::.||..:.||:||..:....|...|     ||            .|.|:|..
  Rat   251 PQYIQGHLVSADLSSSVAAVCGVVLPKQSSSPAEQQTS-----DRSSSRDQELALTSFVLVESVC 310

  Fly   301 VNLRSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIESREKALKKAEEEEQLLT 365
            .||:.:|:.||:...:.|.||:|.|||:|:|:||..|||                          
  Rat   311 KNLQMLAVAVASQNAVLLEGPIGSGKTSLVEHLAAVTGR-------------------------- 349

  Fly   366 PKKKAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLP 430
                                        ||....|::|||||||||||||.||||||||||||.|
  Rat   350 ----------------------------TKPPQLLKVQLGDQTDSKMLLGMYRCTDVPGEFVWQP 386

  Fly   431 GVLTQAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSA 495
            |.||||...|:|:||||:|.|..|..::|..|||...|.:||..|.:|:.|.||||.| |...|.
  Rat   387 GTLTQAATKGHWILLEDIDYAPLDVVSVLIPLLENGELLIPGQGDCLKVAPTFQLFAT-RRLLSC 450

  Fly   496 SNSSQKSLYS---LLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSSGNH--- 554
            ..|..:.|.|   :||||...|::..|.:.:|.:::...||.|.|..:.::|:::..:...|   
  Rat   451 GGSWYRPLNSHAAMLDKYWTKIHLHNLDKKDLREVLQNRYPSLLTATDHLLDIYIELTGEKHCCP 515

  Fly   555 -TSADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSEC 618
             ...|...|:.|  :|:...:.|||            .||.:|.|||:..|:|....|..|||..
  Rat   516 SIGCDEAPQEVS--EAEGENRRVAL------------EGRELSLRDLLNWCNRVAHGFDSTSSTA 566

  Fly   619 AYFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRASL 683
            ...|||.|:|.|.:.|.:..:|:.:...||:||.|.:.:.|.|...|||::......:::||..|
  Rat   567 LLNVFQEALDCFTAMLSEQTKKLKMAEIIGSKLNISKKKAEFFCKLYKPEIVINELDVQVGRVRL 631

  Fly   684 LAKSDLNNSENEDISEQDLKRQKLSQQTRRAIGKVSNKRTTFSFTRLASCILERIAVCVTHSEPV 748
            |.|.          ||               :.::..::.:|:.||.:|.:||::||||:..|||
  Rat   632 LRKQ----------SE---------------VVRIQKEKCSFAATRPSSVLLEQLAVCVSQGEPV 671

  Fly   749 LLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVELNYVLAPLRNEFEYLLCE 813
            |||||||.||||:||:||..|...|.|||||.|||.:||:||||||:...:..|||..||.|..:
  Rat   672 LLVGETGTGKTSAVQHLAHATGQHLRVVNMNQQSDTADLLGGFKPVDHKLIWLPLRETFEELFVQ 736

  Fly   814 TFNQEKNLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPELKANK-------LLPRWQTLREK 871
            ||::::|..||....|.|...|...:::.|    ..|.|:...|..|       |..:|:....:
  Rat   737 TFSKKQNFTFLGHIQTCYRQKRWHDLLKLM----QHVQKSAITKEGKESQPGLLLKEKWEAFGLR 797

  Fly   872 LQKLQMQLDKSIN-ISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLSTILE-PEGSVVLLE 934
            |...|.|:..:.| :.|||:.|:|...|..|:|:||||||||:.|||||||.:|| ..||:|||:
  Rat   798 LNHAQQQMKMTENALLFAFVEGTLAQAIKKGEWILLDEINLAAPETLECLSGLLEGSSGSLVLLD 862

  Fly   935 RGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNRFTEFFVDELTTDADLSLLVSDYLANTGI 999
            |||..|:.||||||:||||||.||:||::||.||||||||.:|:||.:..||.:|:.|||....:
  Rat   863 RGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRNRFTELYVEELESKEDLHILIVDYLKGLSV 927

  Fly  1000 QRKSVHNIVQLYKSLRKLSELQLNDGLGNRPVYSLRTLCRSLRICARNLCGSIERNLYESFCLSF 1064
            .|.:|..||..|.:|||.|:.:|.||.|:||.||||||||:||..|.|.||:|:|:|||.|||.|
  Rat   928 SRSAVQGIVNFYTALRKESKTKLVDGTGHRPHYSLRTLCRALRFAASNPCGNIQRSLYEGFCLGF 992

  Fly  1065 LTQLDPNSHHVVLLLI-QNALLSNVKAILSKQLPQ-LGENYLDFEGYWIQPGNLEPQPCTHYILT 1127
            |||||..||.||..|| |:.:..|||::|.:.:|: .|...:..|||||..|:.||:....|:||
  Rat   993 LTQLDRASHPVVQKLICQHIISGNVKSLLKQPIPEPKGGRLIQVEGYWISVGDKEPKIDETYVLT 1057

  Fly  1128 ESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTYA 1192
            .|||.||:|:||::|.|..|:|:||.||.||||||.::|..:||.|:|||||||||:|||||.|.
  Rat  1058 PSVKLNLRDIARVVSAGTYPVLIQGETSVGKTSLIRWLAAATGNHCVRINNHEHTDIQEYIGCYT 1122

  Fly  1193 ADLDGKLTFREGVLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELYIAETQTLVKAHPNF 1257
            :|..|||.|.||||:.|||.|:||:|||||||.||:||||||:|||||||.|.|||.:|:|||.|
  Rat  1123 SDTSGKLVFNEGVLIDAMRKGYWIVLDELNLAPTDVLEALNRLLDDNRELLITETQEVVRAHPRF 1187

  Fly  1258 MLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIPPTYARKMVQCMTQLQ 1322
            ||||||||||||||||.|||||:|||:||||.::|..||||||.|||.:||:|..|:|:.|.:||
  Rat  1188 MLFATQNPPGLYGGRKVLSRAFRNRFVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLELQ 1252

  Fly  1323 QHRKNTS----KQVF-TLRDLFRWGNRYTHADKSLHDDNRYDWNQHLVEEGYLVLSSKVRSQEEH 1382
            .:|:.:|    ||.| .|||||||..||..|:::..|   |||.|||..:|:::|:.:||.|||.
  Rat  1253 SYRRRSSVFAGKQGFIALRDLFRWAERYRLAEQTEKD---YDWLQHLANDGFMLLAGRVRKQEEA 1314

  Fly  1383 ELIEKTLFANFRKKLDLQTLFDIQTDRE--SSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVT 1445
            ::|::.|..:|:|||..|:||..:...:  |.|.....:|::  .|   ..:|||..|.|:||:.
  Rat  1315 DVIQEVLEKHFKKKLCPQSLFSKENVLKLLSKSSTQTSVLES--KF---SHVVWTEGMRRLAVLV 1374

  Fly  1446 AKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPCRGKES---- 1506
            .:||||.|||||||.|||||||||||.:::::.:|..:|||::.|.:||||||||.|.|.:    
  Rat  1375 GRALEFGEPVLLVGDTGCGKTTVCQLFSALSNQKLYSVNCHLNMETSDFLGGLRPVRQKPNDKEE 1439

  Fly  1507 --TQLFEWADGPLIYAMQEGSYFMADEISLAEDSVLERLNCILEPERTVLLAEKGGISELDASPD 1569
              |:||||.||||:.||:|.|:|:.||||||:||||||||.:||.|:.::|||||.....|...:
  Rat  1440 PDTRLFEWHDGPLVLAMKEDSFFLLDEISLADDSVLERLNSVLEVEKCLVLAEKGSPESKDTEVE 1504

  Fly  1570 FVVQAKSGFQFLATMNPGGDFGKKELSPALRNRFTEVWCLPSDNKEDLIEIAYNCMRRQKEHENQ 1634
            .:...|. |:.|||||||||||||||||||||||||:||..|..:|||::|..:.:|........
  Rat  1505 LLTAGKH-FRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTKREDLVQIINHNLRPGLSLARA 1568

  Fly  1635 AINTHKVAEYLVDVV--LHIRDTNDKFKFSVRDILAWANYMVSNAKLSFAEQAIFGLETI----- 1692
            ......:||.::|.:  |..::...|...|:||||:|.|:|.:.|:    |.|:..||||     
  Rat  1569 GHKGADIAEVMLDFITWLTHQEFGRKCVVSIRDILSWVNFMNTMAE----EAAVKRLETISTVTS 1629

  Fly  1693 FLDALEMLPHESQEQVELLKSNIVKQAIKQASLILQE--KFTLEELSE-KRGTEVELNECR---- 1750
            |:.|..::      .::.:.|.:.......|.|..:|  ||.:::||: .|.||.:.:|.:    
  Rat  1630 FVHAACLV------YIDGIGSGVTSSGFGTALLAREECLKFLIKKLSKVVRLTERQKDELKIYDR 1688

  Fly  1751 ------------FGIRPFFID----VNQERLTSAKEDFLFDAPTTKQNLFRLLSALSLQKPVLLE 1799
                        :|:.||||.    :|...:.    |:...|.||..|..|||.|..|.||:|||
  Rat  1689 LKHKEFTSVDDLWGVHPFFIPRGPVLNGHTIA----DYALSAGTTAMNAQRLLRAAKLNKPILLE 1749

  Fly  1800 GPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAATERQIRSFVWR 1864
            |.|||||||:|.::..|.|..:|||||.|.||:.||||.|||.|..           :...|.|.
  Rat  1750 GSPGVGKTSLVAALAKASGNTLVRINLSEQTDITDLFGADLPVEGG-----------KGGEFAWC 1803

  Fly  1865 DGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKSFHLA-GSTRIFACQNP 1928
            ||||||||||.: |::|||||||.||:||||||..|||||:|:|||..||.:. ..||||.||||
  Rat  1804 DGPLLAALKAGH-WVVLDELNLASQSILEGLNACFDHRGEIYVPELGMSFQVQHEKTRIFGCQNP 1867

  Fly  1929 LKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLNAYFLELLDQKAEGNLFEI 1993
            .:|||||||||:|||||||:|::..|:..|:..:.:..:            ..:|:         
  Rat  1868 FRQGGGRKGLPKSFLNRFTQVFVDPLTVVDMEFIASTLF------------PAIDR--------- 1911

  Fly  1994 YSGKESSCKSDSFDLGARLVRFSEQLDRGV-ASMEFGYKGGPYEFNLRDILRWCDLLHNPQTGYI 2057
                         ::..::|.|:..:|..| ...::|.||||:||||||:.|||.|:       :
  Rat  1912 -------------NIVKKMVAFNNHIDHEVTVEKKWGQKGGPWEFNLRDLFRWCQLM-------L 1956

  Fly  2058 LGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSYIRNVFSTVFLCDAEYLNQVSNDV--- 2119
            :..||..:...         :.:.|:|.:|||..:||..:..||..||         .||.:   
  Rat  1957 VDQSPGCYDPG---------QHVFLIYGERMRTREDKEKVITVFKDVF---------ASNSMPYI 2003

  Fly  2120 ---ALYWTADKVYLNDVVLSRKQADVLDLVNRQEQSPL-LLDSQRQQLKQIIETVHMEKPLLLCG 2180
               ..:.|...|.:...||||.     ..|....:.|| ||....|.|:.|::.|.|...::|.|
  Rat  2004 GTRLFHITPYDVQIGYSVLSRS-----SYVPHPSRRPLSLLHQSLQSLEPIMKCVQMSWMVILVG 2063

  Fly  2181 STDSGKTKLIDALCVLSNR-----LCNTDIIDDSVTGSFQQIDLNRHLEIIYKKVETLVFSCVQR 2240
            ....|||.|:..|..|:..     ..|:.:....:.|.|:|:|:.|...::.:|||..|...::.
  Rat  2064 PASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTELLGGFEQVDIIRPWRLLLEKVERAVRVLLRD 2128

  Fly  2241 AFVLHT-QSEFVEQLWNNWSMYNKLAKVTTEAQQHSVLDELKLFSER---LGSLGK--IIEVLEA 2299
            :.:::. .:|.|.:.|:::                       |.:.|   ||..||  .||::. 
  Rat  2129 SLLINADDTEVVLRAWSHF-----------------------LLTYRPKCLGEDGKGVTIEIVN- 2169

  Fly  2300 TPQNCQVRALQQLAEIKSQLLLLQ-------TYIKT------------------ADSLNTGGSFE 2339
                          ::::.|||||       :|.|.                  :.|..:.||||
  Rat  2170 --------------KLEAVLLLLQRLNNKINSYSKADFAKLVEDFRTFGVKLLQSTSGRSHGSFE 2220

  Fly  2340 WVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYKSTNFR 2404
            ||||.:|.:||.|.::|:::||.|:.:||||||.:.||.|.|.|.|:|: ...|...|..:.|||
  Rat  2221 WVDSMLVQALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTINERGM-VDGSTCTVTPNPNFR 2284

  Fly  2405 AFLTVDPKNGELSRAMRNRCVELSLSRDTYSVD----DLRAFVHEQGVREMEAIDCILRVHKGLS 2465
            .||::||.:||:|||||||.:|:.:|.:.....    ||:..:|..|:......:.:|.:|.|:.
  Rat  2285 LFLSMDPVHGEISRAMRNRGLEIYISEEKEGSILENLDLKVLLHSLGLVGDSLCNVLLALHTGVQ 2349

  Fly  2466 QLTEFN-NYSISHLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVYS----ANTDLMGYGLSYYQN 2525
            .|.:.: ..|:|.|:..|.|...|.:.|..|.:|.:.|..||||.|    ||..|:...|..:..
  Rat  2350 SLVKGSPTSSVSTLSHTAILIVQYLQRGLSLDKAFFEACWEVYVCSQHSAANQKLVQALLESHTA 2414

  Fly  2526 KLR------EVVLA--------QTEVF----EEVAVIQEDFLSDVI---LNSGNLNSLTLIKRQA 2569
            .||      ..:||        .:.:|    ..:||::.|  ..::   ||..:|.:::..:.|.
  Rat  2415 SLRAKETWGHSILATGLWPDSVPSALFATEDSRLAVVRSD--GQILAYCLNRLSLRTISWTRSQP 2477

  Fly  2570 VALKVLLDGYTEGKIPQKLLASLFHEMEKLKLDQRNPQKLIRHFLYMLYESSAIGDLELRHLYLQ 2634
            :.|:. |:...:...|:.|..:.. |::...:|:   .:::...:.:|.|.:...|..||    .
  Rat  2478 LTLQD-LEHIMQTSNPENLTFNAV-EVDTCWVDE---PEVLAMAVKLLIERATNQDWMLR----V 2533

  Fly  2635 PWLSKDTAFQELSQNLYNCLQK-RSNTDTGTLANLPWNRKLIPRLRDYSTAESNSELNPL----- 2693
            .|||      .|::|:...|:. ||:.:....|           ||.:..|..::.::.:     
  Rat  2534 KWLS------HLAKNIPQGLEAVRSHVEASATA-----------LRKFYAASLSAGVSNVLKILQ 2581

  Fly  2694 ---------------NLSALLLARLVVDIIP--------------VSSVTTVQ------------ 2717
                           |:.||.:.|..:|..|              |::.|.:.            
  Rat  2582 TNITDDFVIPWDPRWNMQALDIIRNSLDFDPQSDQAEQLFELLESVANKTIIYLDREKRIFTEAN 2646

  Fly  2718 ---------QMNALQYSQALCKKQVTEKYANH-LLANFSSFLEVLHTSLLEDLETADLDLPQYAH 2772
                     :.|||:.|....|...|.....| ::||.::|.|::...:|..:::....:|. ||
  Rat  2647 LLSVGSKKLRSNALRMSFEFHKDPETYHSPPHEIVANLAAFFELIDGLILLWVQSPQGMVPD-AH 2710

  Fly  2773 ---LVTRFHWFNRILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHLLVPLIELTAKSGCARMLT 2834
               ::....|.:|..|.|....:..:.|.:     |.||:.|:.|||:..:.:|        ::.
  Rat  2711 VNKILGSMQWRDRFWAVADAVTVDASGLAL-----LALHWHWVSKHLIRQIPQL--------LVN 2762

  Fly  2835 IQDRTLK----------------------IKKYIEETRRPLNVTCKIYSKQFTQFQPYYQDQQIQ 2877
            .:|:..|                      :||......||.....|:....|:|.|...:...|.
  Rat  2763 HEDKYYKEVQMVSEQIHSCLGSPAGSFPGVKKLQAFLGRPFPFKDKLVVDCFSQLQALNRALSIG 2827

  Fly  2878 RHIEL-------DDLEKLLSVVPSYGNLELSSWLKRWLLLQTDDANKWRSFLRKHTNGFQPKAFE 2935
            ..:.:       :|:.: |.||.|..||:.|       ||||     |...||            
  Rat  2828 ERLPVFGECGWQEDINR-LQVVASEWNLKKS-------LLQT-----WGLILR------------ 2867

  Fly  2936 ISGSLRNETLQSHLQKLQTTLKEAQENSAEIEMDLELDLNSIKTLLEAETEE------SESYI-- 2992
                                        |.|..|:.||  .:|.|:..:..|      |..::  
  Rat  2868 ----------------------------ANILEDVNLD--ELKNLVNTQCSELKTRGLSHGFLEK 2902

  Fly  2993 -HPDGIPTNTPKLLIAA--------------LRELFMERLLTG----------TLRDDFDEQVN- 3031
             |....|:. |.|...|              |..|:..|:..|          :.....||::: 
  Rat  2903 AHEASSPSQ-PDLSSLAHLTRRVQLWPVTEYLAVLWQYRVTAGFVTQACLRRSSTHQQMDEEISH 2966

  Fly  3032 ---------PLYADQLLTLNSNLWHCLKTLESANRTEITNAWIELKNEV------NELQNYDEFA 3081
                     |:...:|.    |||..|. ::..:..|::..|.||....      :.:....|:.
  Rat  2967 CITFCLKHTPIAPQKLW----NLWSLLH-IQKLSAQEVSCLWSELFTSTFGSSWSSPVTTNPEYW 3026

  Fly  3082 VLLEKIGGGYKGLRSYQRQYRNSVQCYQLENLSTRLD-CVQGPSEEGS--TDISSQFCYRGPALS 3143
            :.       :..|.:.|.|          |...:|.| .::||   ||  ..:.|:.|:      
  Rat  3027 LT-------WSPLPNAQPQ----------EMPRSRWDSTLKGP---GSLCRAVFSKCCF------ 3065

  Fly  3144 GVILSLICQPNGQLRSVP--------LSELLEWRSALQQTRHLIWEN----------------SQ 3184
            ||:.:.....:..:..:|        |.|.:|....||..|.|:|.|                ..
  Rat  3066 GVLTNSSSGSSWDVSGLPLLSSSHVTLGEWVERAQQLQDIRSLLWTNMTVPSVAEFRRTDSRLQG 3130

  Fly  3185 LLTSRYSGEVNNLLQA------KENARQLLKELEYVRKLSEKEQK-AN-QGFENCAKELEKMI-- 3239
            |:..||...:..||.|      .:|...||  |...:.....:|. || .|.|...|||..::  
  Rat  3131 LVLCRYLLGLTELLPAPQRQEYMQNCEHLL--LGNTQAFHHVDQTLANIGGQEVLPKELFCLLLT 3193

  Fly  3240 -------EKLEKEENNNASMTKDFEVSLTNALVGAIELCLLTNTPLIDPVEKNRLKNEYIAEDI- 3296
                   |...|:....|:......|||     |.:::.........||..|...|.:|..|:: 
  Rat  3194 SLHYFIGEGESKQNLREAARRGRLWVSL-----GLLQIQTWVPQTRFDPAVKKAYKLKYAQEELC 3253

  Fly  3297 ---------DCLSTLTTAYDFMKIAMKYRHFGEEIYSELELRLRTALQR-------QQQLSQKLA 3345
                     :.||.|.|..|..         .:.|.|.....:|...||       ...||:|.|
  Rat  3254 QLQCELKTRNLLSHLQTGRDLE---------DDIIASHSHPHIRLLPQRISHLENLVHSLSKKQA 3309

  Fly  3346 LRSEKCLYASLVQDITHFLHSNGDC----ESLYKLFQLIHSEWENFQGLHVATSAQLKSSIEVLG 3406
            .|.....|.:|||:|.|::.|....    :.|.:|.|.:|::...        |||:..::  |.
  Rat  3310 FRPHLPSYETLVQEIHHYVTSIAKVTAVQDLLMRLLQALHTDGPK--------SAQVLQNL--LK 3364

  Fly  3407 KLDLWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLESLKVIFTRVQQA--GSVSQAEQ 3469
            :...|..:.|:|....:..| |.|.|.|.|::.|:.||:.|   ::::.:.|..:  .||...|.
  Rat  3365 EEASWQQSHQQFRKRLVEEY-ALYPDTVTPLQASILQLQHG---MRLVASEVHASLHSSVICTEH 3425

  Fly  3470 MQQTIGDIVQFPSQHP---------------------------LVIRNSRLYGLLAELPHSEYEY 3507
            ::.....::.|||..|                           :|.|.:|......:.|:...| 
  Rat  3426 VEALAMAVLAFPSVGPSFPTYHAHADALCSVNSAEALRGLGKLMVKRAARKEEGKNQQPYPTRE- 3489

  Fly  3508 FRLLKAKLSELSNYIALGRVIDETTFAAYDDALSICNQTWQQEEHRRCQLKAEAE-SLYVTKTKG 3571
             :||...|..|.:::.....:|:.....:..........|.::| |..|.|||.| |||..:::.
  Rat  3490 -QLLMNALLYLRSHVLCKGELDQRALLLFRHLCQEIINEWDEQE-RIAQEKAEQESSLYRCRSRS 3552

  Fly  3572 ---GVDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASAKDKQSQIVVEEDYAFL 3633
               .:..||..|: |:...||.: ::|||:.:.:||||:      |..|.|.:.   ...|.|.|
  Rat  3553 CRTALSEEEEDEL-ELRKLFPLH-EKDFADILMEPTLEE------KRRASDGRE---AATDPALL 3606

  Fly  3634 ARNFID-VMTRHTQV---------YYKEQPKSSKELELHLLAPYQARFQVFANLHGHYKTALGSS 3688
            :::.:. ||..|.|:         |.:..|....|   |.|:.:.:.:|..|:|..|:...:|..
  Rat  3607 SQSSMQAVMLIHQQLCLSFARSLWYQQSVPAHEAE---HYLSLFFSCYQTGASLLTHFYHLMGVE 3668

  Fly  3689 LEERACNGLAFGLALQQKQL-----RDIELEEGVSSSPYDFYKDSNISEIQSCLDVMERIEKRVL 3748
            :.::..........|....|     .|:.::   ...|||||:..|::|.:.|..|::.:.:.|.
  Rat  3669 MNDQLLGSQLLACTLSSNTLCGEATSDLMMK---PDGPYDFYQHPNVAEARQCQPVLQGLSEAVS 3730

  Fly  3749 EQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLALWNEVAHRNNNLVSEEIEV 3813
            :.|:.:|||..|..:.:|:.|||..|..:|:.:...|.::|..|...|.|.|.|..:|......|
  Rat  3731 QLLQDWPEHPVLEQLLIVMDRIRGFPLSSPISKLLNGLEILLAKAQDWEENASRELSLRKHLDLV 3795

  Fly  3814 AEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYNLLQQFIHQKQLDHSYTDIKLAEQRFA 3878
            ::.:.||.:|||..|...|..|..:...::.::||.||.:|::.:.::                 
  Rat  3796 SQMIIRWRKLELNCWSMSLDNTMRRHTEKSTKHWFSIYQMLEKHMQER----------------- 3843

  Fly  3879 QDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQGFELYLHNVERAGKINGLPP 3943
                  .::..:.:.:.|..:|..|:.|:|.|..|:||:|||:|..|..:   |....::.|...
  Rat  3844 ------TEEQEDDKPMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHCH---VLLMPQVEGKDS 3899

  Fly  3944 LIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKDLSYFSMRNSVASVHRNLNK 4008
            |.:.|.||..::.||...:.......||||||:|||||||..:: |:|::|::.||...||.|.|
  Rat  3900 LCSVLWNLYHFYKQFLDPVQAKIVELRSPIEKELKEFVKISKWN-DVSFWSIKQSVEKTHRTLFK 3963

  Fly  4009 FLKEYRLSIQEKISEVFQPKDSTAKDYTFGTDKGKGLRNYNKIKYLHTERQQFVASEKLLEKFAI 4073
            |:|::...:.|.........:...:.........:.....:.|:.|::..::.:.::.:..:.:.
  Rat  3964 FMKKFEAVLNEPCQSCLVESNKEEQPDCLPKPTEEATMETSPIQALNSALRETLLAQPIAWQPSG 4028

  Fly  4074 QEE-------FLSDNTLLQRLDKHFRTARHVVKETLGQVPYGELITELDDLLASQLERCEHLRSL 4131
            .|:       ...:..||:||.:..:..|.|....:.:.|...|:..||......:.....|:||
  Rat  4029 TEQCQDAVGPLSMEGELLRRLPRLSKRMRKVCLIFMKESPLPHLVESLDQFTGGVISSVSELQSL 4093

  Fly  4132 NVDRSKERPQQKQEAKQILQQKRKALTDLFKMLHRLGANYKTGLLELSLRNEFEDFQLPPYSIRS 4196
            .||.|.|:.:|..|||.||.||.:||:||||.|.::|.:|:.||.....::..|...|.|..::|
  Rat  4094 TVDPSAEKEKQHSEAKHILMQKHRALSDLFKHLAKIGLSYRKGLAWARSKSPQELLHLHPLDLQS 4158

  Fly  4197 MLPRLHPTAQQLDEHL----DLYYMKSVFKLKLL------QNIMLTPL--------SELGPPNIE 4243
            .|..:..| ::.|..|    .|...|||..::||      |.:...|.        .|:...|::
  Rat  4159 ALSIVSST-READSRLVCTDTLVKFKSVLLVELLVCVLGGQRLSAMPSVCFFSSSGQEISMGNVD 4222

  Fly  4244 RIKGFAVDLFLLVQQQREHLSGSTKELHELRNSLDSLRKLAEIIPQADINPSTLNFVKSADIAME 4308
            |.|||:..|..|:.:||..|:..|::...|||.|..::::...:....:.|.......|.....|
  Rat  4223 RCKGFSAHLMKLLIRQRHSLTTLTEQWIILRNLLSCVQEIHSRLIGPPVYPVAFPPQDSVQQWTE 4287

  Fly  4309 IKQHL-RQIHYVLKQWKLLLSCAPS------------------SFIEESENR---------LLVR 4345
            ..||| .|...:|:|:..||.|.||                  |.:|:.:.:         ||..
  Rat  4288 RLQHLAMQSQILLEQFSWLLQCCPSVGPTEGHSDAPFQEHPSASHLEKVDTKGPIAGAMPDLLPS 4352

  Fly  4346 KIS----LAQSELHSLC-----IQILNSSQELLNEL------NNANLEYLSSEKCVTYQKSYAEI 4395
            .:|    :.:|:|.|.|     .|:...|...|.|:      ..|.::.:..:.|.|...::.: 
  Rat  4353 ALSYPSPVPRSQLPSGCRMRRQDQLWQQSTAGLTEMLKTIKTMKAGVDKIRQQSCETLFHTWED- 4416

  Fly  4396 QENIKKTLELLRTGQN-----------------------DYLPLAQPIVELLDSVQLKNHTEIAP 4437
                   .|:..:|.|                       :.......:||.||.::    .||: 
  Rat  4417 -------FEVCSSGLNCLSQVSAHLQGLASLFILPGIEVEKTDSQMALVESLDYLR----GEIS- 4469

  Fly  4438 EAIDLANADTELANIAH-------------------------SVLMSMQKIYKHHVK------TD 4471
            :|:|...|......|||                         ::|.::|.:.:.:.|      .|
  Rat  4470 KAVDDFTAWKARLFIAHKQGGNQMLEESFVEDFSEQVESAIRAILCTIQNLAERNSKKAEDSAAD 4534

  Fly  4472 EVNQNGEAKEQDEESKEALQEQHLKKCLTGELTSDWQQLSLPRVLGKLSNVLLVLKHSHFEG--- 4533
            :..|..:..:::|.|.::||..||.|.|..:..:....|.:.:::..:|.:|..||....:|   
  Rat  4535 KRLQEEDGGKEEEASFKSLQPGHLTKLLEDDFWASVSTLHVQKIISSVSELLERLKSCSEDGNTT 4599

  Fly  4534 KDKL------LCVRRAIGLLPVLEQYQLLADYLLLQQLATHKVSAKMLSIVLTVFVEIGSKGFCV 4592
            |.|:      |.||    |:|:|..:..|..:.|...||||:.:||:||::...|.|:..||||:
  Rat  4600 KHKVFSQSCGLLVR----LIPMLCGFSDLILFFLTISLATHRSTAKLLSVLTQTFTELALKGFCL 4660

  Fly  4593 PPDLMQDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRPEDRKDEGD-KQEPDCK 4656
            |.:|::|..|:...:..:.||.|:.||.|..|.||:||:|:|::|..:....||:.| ..:||.|
  Rat  4661 PKELIEDSAGEGAMQFHDYEGGGIGDGEGVKDVSDRIENEEQVEDTFQKGQEKDKEDLDSKPDTK 4725

  Fly  4657 -EEKGIEMSDDFDAKMQDVE-KPEEDDSGESEEEEDLNKEMGETE-EGAEKLDDQIWGDDEEEKP 4718
             |:..:|||:|||.||.|.| :.||||.....|:.||:|:||... |.|:|||:::|||||||..
  Rat  4726 GEDSAVEMSEDFDGKMHDGELEQEEDDEKSDSEDGDLDKQMGNLNGEEADKLDERLWGDDEEEDE 4790

  Fly  4719 E-----EEQEPDMNEEDQGKGSKDEK-DAHNDLDTKNDAAKEDGKDEHEKDGLDATNEPSGEDKR 4777
            :     ||..|.|:|||....:||:. ||.|    .|...|..|::|        .:||  ||..
  Rat  4791 DDDGKGEEAGPGMDEEDSELVAKDDNLDAGN----LNKNKKHQGEEE--------DSEP--EDVE 4841

  Fly  4778 KEQAKDIDDMKDPEMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDE-----GHDDQDEQPTDENP 4837
            :.|.|..:.|.:.|.||.:.:..|...|:.||||.:||.|...:|.     |.|..:|:..:|||
  Rat  4842 QGQEKINEQMDEREYDESEVDPYHGSQEQLPEPEALDLPDDLKLDSEDRSAGEDTDNEEAEEENP 4906

  Fly  4838 FDIDA----MKENMQPAEEPEA---DGDDEHDANE---EGDPQSD-GSDSEEDEAGTEAKPAEED 4891
            .:|..    |:|..:..|||:|   :|:.....:|   ||:...| |:|.::.:..:.|:..||:
  Rat  4907 LEIKEKTVDMEEIDREVEEPDAAQSEGERPPAPDEGPGEGEESMDTGADDQDKDTASHAEEQEEE 4971

  Fly  4892 HGEGEEA-TPEDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKE 4955
            . ||||. ..|:|:|.|.|...|    |....|.|  :|.:.:|||:..||.:...|..:...::
  Rat  4972 E-EGEEGEEEEEEEDRAATDGSG----ESGVSPVD--KDLQPQKEEEEGEKSDAEEQVPEATERK 5029

  Fly  4956 ENVQSMPETDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAE-NDADDGGHQG--VAET 5017
            |:     ::...:..|.||..|..::.  ....|:|.|:|:.|.|.|: |.|:  ||:.  :|. 
  Rat  5030 EH-----DSCGQTGVDNVQSAQAVELA--GAAPEKEQGKEEHGSGAADANQAE--GHESNFIAR- 5084

  Fly  5018 QETVSQEDRKNERQTQEKRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMD 5082
               :|.:...|:.....||:.|:.:.|||:|:..::..|:|:|:|  .|.|    .|||..:|..
  Rat  5085 ---LSSQQHTNKNTQSFKRRPGQADNERSIGDPNEHVRKRLRTVD--TDRK----TEQEPAQPQA 5140

  Fly  5083 QTE-AEEYQHVKEPKNS-DKTTLDNATEEQSKKIQHQEDEPPNEEEIEAENVDELMEAEEPAVDP 5145
            |.| |:.::|:::..:: |..|.|.|:.|     |.|..:...|::.|.|..|.||:.||..:..
  Rat  5141 QVEDADTFEHIQQGSDAYDAQTYDVASSE-----QQQTTKASGEDQEEEEKEDILMDTEEELIRA 5200

  Fly  5146 EDDAEL--EQLGAE------KTEQKSDKPS-KTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETT 5201
            ||..:|  |.:.:|      .:|.:.|..: ||::.::...|....|||.|     ...||.|:|
  Rat  5201 EDTEQLKPEAVRSETATASGSSEMEVDMQTLKTKEDEDPRTTTSHQEIESE-----RPERSREST 5260

  Fly  5202 AHSNSEILLDK--SSHAEDLSSAEQIELRQQYQKQLTTFRV-----AQPEHEDYETWQGISNRMT 5259
            .|:..::|:|.  ....:|:|     ||||:.::||.|::.     |:.|....|.||.......
  Rat  5261 IHTLHQLLVDTVFQPFLKDIS-----ELRQEMERQLETWQTHNYGNAEEEKAAAEMWQNYLVLTA 5320

  Fly  5260 QNARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKIT 5324
            ..:::|||||||:||||:..:|:||||||:|:||:|||||||||||||:||||||||::|.|:|.
  Rat  5321 ALSQQLCEQLRLLLEPTQAAKLRGDYRTGKRLNMRKIIPYIASQFRKDRIWLRRTKPSKRQYQIC 5385

  Fly  5325 IAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQIILNHTEQFD---GPRLV 5386
            :|||||.||..|::|.|..|:::::..||||||.|::::.||||:.:::....|||:   |.:::
  Rat  5386 LAIDDSSSMVDNHTKQLAFESLAVIGNALTLLEVGQIAVCSFGESVKLLHPFHEQFNDSSGSQIL 5450

  Fly  5387 NALNFAQDKTKIAGLLNFI----RTANAEESGTGGDNGLFENLLLILSDGRNIFSEGAQNVKNAI 5447
            ....|.|.|||||..|..:    ..|......|..:..   .||||:||||.:|.||...|..|:
  Rat  5451 RLCKFQQRKTKIAQFLESVAIMFAAAQKLSQNTSPETA---QLLLIVSDGRGLFLEGKDRVLAAV 5512

  Fly  5448 KLARLQRIFLVYIIIDNPDNKNSILDIQHVAVNADGSV-NINSYLDSFPFPYYVIVRDLNQLPLV 5511
            :.|:...||::::::|||::::|||||:.......|.: .|.||::.||||:|:|:||:|.||..
  Rat  5513 QAAQNANIFVIFVVLDNPNSRDSILDIKVPIFKGPGEMPEIRSYMEEFPFPFYIILRDVNALPET 5577

  Fly  5512 LSEAMRQWFELVNS 5525
            ||:|:|||||||.:
  Rat  5578 LSDALRQWFELVTA 5591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1843/5797 (32%)
P-loop_NTPase 315..505 CDD:304359 76/190 (40%)
P-loop_NTPase <887..972 CDD:304359 57/86 (66%)
P-loop_NTPase 1147..1283 CDD:304359 100/136 (74%)
P-loop_NTPase 1454..1603 CDD:304359 93/155 (60%)
P-loop_NTPase 1795..1946 CDD:304359 92/152 (61%)
P-loop_NTPase <2335..>2378 CDD:304359 24/43 (56%)
Prothymosin 4843..4920 CDD:281265 27/85 (32%)
PHA03151 4856..5060 CDD:177546 58/212 (27%)
MttA_Hcf106 <5046..5166 CDD:294511 38/130 (29%)
vWA_midasin 5261..5526 CDD:238737 130/274 (47%)
Mdn1XP_017458400.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H39689
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138219at2759
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22908
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.