DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and CG9915

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001097000.1 Gene:CG9915 FlyBaseID:FBgn0030738 Length:820 Species:Drosophila melanogaster

Alignment Length:410 Identity:75/411 (18%)
Similarity:148/411 (36%) Gaps:81/411 (20%)


  Fly  4874 SDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAET---QKRGELEDEDDSKPEDSPEDSKE--- 4932
            |.|....:|:.::......|..:.:........::|   :||..:.:.||    |.|:.:|:   
  Fly   423 SGSRRSRSGSRSRSRSISGGSRKGSRSRSGSAASQTASRRKRRAISESDD----DGPKVTKKRVK 483

  Fly  4933 ----EKEEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQDPDIKQDQKLDEQETG 4993
                :.||..::|.....:|:||.::..:.::.|.:::..:::.:   .|.|....:|.:|:...
  Fly   484 ITDTDNEEDEQDKGIGKEKSQDKITESSDDENTPISNEPENSNFI---SDFDAMLMRKKEEKRVR 545

  Fly  4994 EEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQTQEKRKQGRTNEERSLGEAEQNKLKQL 5058
            ..|..: ...||.||...|.:. :.:..|.:||                :...:|:....|:..|
  Fly   546 RRKRDI-DLINDNDDLIDQLIV-SMKNASDDDR----------------QLNMIGQPATKKISML 592

  Fly  5059 KTIDQLKDSKESDDAEQE-----------KPEPMDQTEAEEYQHVKEPKNSDKTTLDNATEEQS- 5111
            |.:......|....|..|           .|.|.......:.:.......||..|::....:|| 
  Fly   593 KQVMSQLIKKHLQLAFLEHNILNVLTDWLAPLPNKSLPCLQIRESILKLLSDFPTIEKGLLKQSG 657

  Fly  5112 --KKI----QHQEDEPPNEE---EIEAE------NVD---ELMEAEEPAVDPEDDAELEQLGAEK 5158
              |.:    :|.::...|.:   .:.:|      ||.   ..|..||     ..:.:|.|:...:
  Fly   658 IGKAVMYLYKHPQETKSNRDRAGRLISEWARPIFNVSCNFSAMSKEE-----RQERDLAQMSRHR 717

  Fly  5159 TEQKSDKPSKTEKS---KEQLETPEGMEIEGEV--VLTMTVPRSSETTAHSNSEILLDKSSHAED 5218
            .:....:||.:.|:   .:.|...:.|...|:.  |....||..      ||.:.::...|..|.
  Fly   718 HKSPDTEPSSSSKAPTLNQTLSNEDKMLRPGDPGWVARARVPMP------SNKDYVIRPKSTVEG 776

  Fly  5219 LSSAEQIELRQQYQKQLTTF 5238
            ..||.......:|:|.:..|
  Fly   777 EVSASTKRKPNRYEKHMKRF 796

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 75/411 (18%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 8/49 (16%)
PHA03151 4856..5060 CDD:177546 36/196 (18%)
MttA_Hcf106 <5046..5166 CDD:294511 25/150 (17%)
vWA_midasin 5261..5526 CDD:238737
CG9915NP_001097000.1 TFIIS_I <568..775 CDD:294098 40/234 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117239352
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.