DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and C530008M17Rik

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_006535065.1 Gene:C530008M17Rik MGIID:2444817 Length:1297 Species:Mus musculus

Alignment Length:1397 Identity:269/1398 (19%)
Similarity:476/1398 (34%) Gaps:448/1398 (32%)


  Fly  4296 TLNFVKSADIAMEIKQHLRQIHYVLKQWKLLLSCAPSSFIEESENRLLVRKISL--AQSELHSLC 4358
            |:..:...:|..::|...||:...:|            |.:...|.:.::|...  |.||...  
Mouse    29 TVQAMSQDNILGKVKTLQRQLGKNIK------------FGQRPSNAIPMKKAGSTDASSEEDF-- 79

  Fly  4359 IQILNSSQELL-------NELNNANLEYLSSEKCVTYQKSYAEIQENI--------KKTLELLRT 4408
              :|.|..|::       ::..|.:.:..||...:...::.::::|.:        |:.|....|
Mouse    80 --VLTSPMEIVTQQDIVPSDTENKSSDTPSSSSPLNLPEAGSDMEEKVAPVKPSRPKRHLSSAGT 142

  Fly  4409 GQN---DYLPLAQPIVELLDSVQLKNHTEIAPE-----------AIDLAN------------ADT 4447
            .::   |.:|||   :..||:...::...:.|:           |.|..|            .:.
Mouse   143 IESVNLDAIPLA---IARLDNSAARHKLAVKPKNQRVSRKHRWLAQDRQNEPGSFESQSSLDQNG 204

  Fly  4448 ELANIAH-------SVLMSMQKIYKHHVKTDEV-----NQNGEAKE---QDEESKEALQEQHLKK 4497
            :|....|       ..|.|.::...|.....|:     .|..||.|   |:|:.::||:.:..::
Mouse   205 QLGEDKHIWHGEEPEPLESHEEKRLHEEYWRELEAKCKRQKAEAAEKRRQEEQRRQALERRLWEE 269

  Fly  4498 CLTGELT----------------SDWQQLSLPRVLGKLSNVLLVLKHSHFEGKDKLLCVRRAIGL 4546
            .|..||.                .:.:::.|....||:..     :..|..|.::..|..:.:| 
Mouse   270 SLRQELLEEEEEGEEEEEVKEEGEEGEEVGLQPRAGKVPP-----EEGHQSGPEEQRCTEQELG- 328

  Fly  4547 LPVLEQYQLLADYLLLQQLATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKNG 4611
             ...:..:|.|:....:|....:.:.|                      |.|.|..:.::|.|..
Mouse   329 -GADDPARLEAEERRREQEEAERQAEK----------------------LRQREAERQEEEQKQR 370

  Fly  4612 EGFGLEDGTGENDA---SDKI---ESEDQLDDAKRPED-------RKDEGDKQEPDCKEEKGIEM 4663
            |....|:...:.:|   ::|:   |:|.|.::|::.|.       |:.|.::||.:.::.:..|.
Mouse   371 EAERQEEEARQCEAERQAEKLRQREAERQEEEARQREAERQAEKLRQREAERQEEELRQREEAER 435

  Fly  4664 SDDF---DAKMQDVE----------KPEEDDSGESEEEEDLNKEMGE----------TEEGAE-- 4703
            .:..   ||:.|:.|          ..|||..|..:|||:..|.:.|          .|||.:  
Mouse   436 QEKLRQRDAESQEEELRQREAERQRAQEEDAKGMLQEEEEEAKRIEELKGKETPEPLVEEGPQSP 500

  Fly  4704 KLDDQIWGDDEE----------EKPEEEQEPDMN--------EEDQGKGSKDEKDAHNDLDTKND 4750
            :.:.|.|..|:.          |||.|.:..|:.        ||.:|:|...|:.  .|||....
Mouse   501 EGESQPWLTDDADQRSPLQRDLEKPGEREREDLESAGQREIAEEPRGEGEPAEQS--GDLDAHCG 563

  Fly  4751 AAKEDGKDEHEKDG-------LDATNEPSGEDKRKEQAKDID----DMKDPEMDEEQT------- 4797
            ....:||:..:.|.       ::.|..|   ::.:..|.|||    :::..|:||.||       
Mouse   564 GVDGEGKETAQTDSPQPQERQMEGTPAP---EENEATAADIDRKVEELRWQEVDERQTMPRPYTF 625

  Fly  4798 ------------------------NAMHNELEEPPEPE----------------------EMDLG 4816
                                    .::....:|||.|.                      ....|
Mouse   626 QVSSGSRQILFPKVNLSPVTPAKDASLAPAAQEPPAPRGAASHALPSALSIPHTAILVTGAQLCG 690

  Fly  4817 DMNNVDEGHD---------DQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDA--------- 4863
            ...|:.:..|         .::::|.|....:..|.....:||  ||:..:....|         
Mouse   691 PAVNLSQIKDTACKSLLGLSEEKRPMDVPTVESRAGSGKSRPA--PESPSNAAALAEWASIRSRI 753

  Fly  4864 --NEEGDPQSDGSDSEEDEAGTEAKPAE--EDHGEGEEATPEDEK-----------DEAETQKRG 4913
              |.|||.:   .|.|...||.|..|..  :..|......|.:.|           |......|.
Mouse   754 LKNSEGDQR---GDREPARAGDEPVPRARCDSRGNVRRTPPVNAKFSIMPAWQKFSDSGAETFRQ 815

  Fly  4914 ELEDEDD-SKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPE-TDQSSSADQVQQP 4976
            .|:.|.. .||..:|.:         |..|:.|:     |:::|..|..|: ||....|..:...
Mouse   816 SLDGESGRKKPGLAPSE---------ETAPQPHA-----AAQQEVSQEPPDTTDGCKFAKDLPSF 866

  Fly  4977 QDPDIKQDQK----------LDEQETGEEKDGVGQAENDADDGGHQ-----GVAETQETVSQEDR 5026
            ..|.:...||          ||.:.|.:    ||..: .|..||.:     |:...:...|....
Mouse   867 LVPGLPSPQKAASRTESTTTLDSETTSD----VGNPD-PAMPGGEEKASPFGIKLRRTNYSLRFH 926

  Fly  5027 KNERQTQEKRKQ---------GRTNEERSL-GEAEQNK--LKQLKTIDQ--------LKDSKESD 5071
            .:::..|:|:|:         |.|....|: ||:|...  ||...::.|        .|||.||.
Mouse   927 CDQQAEQKKKKRHSSTGDSVGGATPATGSVSGESEPEATFLKHGPSLPQERKPALSPRKDSAESH 991

  Fly  5072 D-------AEQEKPEPMDQTEAEEYQHVKE-----------PKNSDKT----------------- 5101
            .       |:...|....||.|.|......           ||.:.:|                 
Mouse   992 SSGHYVAVAQSGLPPASGQTPAPEQDRAVSKMPSMQKPALAPKPASQTPPSSPLSKLSRPHLVEL 1056

  Fly  5102 ------TLDNATEEQSKKIQHQEDEPPN---EEEIEAENVDEL-MEAEEPAVDPEDDAELEQLGA 5156
                  .||:...|.:|  :..:::||:   .||::.:..||. :..::||..|        |.|
Mouse  1057 LARRAGKLDSEPSETAK--ESSDNQPPSPSLPEELKGQKRDEKDVPEKKPASPP--------LPA 1111

  Fly  5157 EKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETTAHSNSEILLDKSSHAEDLSS 5221
            .:.|:.|..|....|.|..|:                       :.||     ||.|...|.:.:
Mouse  1112 GQQERPSLIPETGRKEKPVLQ-----------------------SRHS-----LDGSKVTEKVET 1148

  Fly  5222 AEQIELRQQYQKQLTTFRVAQPEHEDYETWQGISNRMTQNARELCEQLRLILEPTKCTRLKGDYR 5286
            |:.:.:....||| ..||..|...|:           .:.|||..:..:|..|....:...|..|
Mouse  1149 AQPLWITLALQKQ-KGFREQQATREE-----------RKQAREAKQAEKLSKETVSVSLQPGSSR 1201

  Fly  5287 TGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYK-------ITIAIDD---SKSMHHNNSKTL 5341
            ..:...:.|  |...|:.:|.:..:.|.:..::..|       :|:.|.|   |.::..:.:|..
Mouse  1202 ASKTAPVHK--PAAPSEEKKPETAVSRLQRREQLKKSNTLPTSVTVEISDSAPSAALVKDVTKRF 1264

  Fly  5342 TLEAISLVSQALTLLESGRLSIVSFGEAPQII 5373
            :....:.||.....|...:....::.:.||||
Mouse  1265 STPDAAPVSTEPAWLALAKRKAKAWSDCPQII 1296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 269/1398 (19%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 22/101 (22%)
PHA03151 4856..5060 CDD:177546 55/257 (21%)
MttA_Hcf106 <5046..5166 CDD:294511 38/176 (22%)
vWA_midasin 5261..5526 CDD:238737 25/124 (20%)
C530008M17RikXP_006535065.1 DUF4592 51..178 CDD:291915 24/146 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.