DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and SPCC737.08

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_588370.1 Gene:SPCC737.08 PomBaseID:SPCC737.08 Length:4717 Species:Schizosaccharomyces pombe

Alignment Length:5682 Identity:1525/5683 (27%)
Similarity:2444/5683 (43%) Gaps:1413/5683 (25%)


  Fly   215 NEKISTKTRLEFDQEREQAWNTARNTLCSYTPDASDQLLNLHLHGINKSVTNIEGVLLPTFNEEN 279
            ||:||...||.......:.....:|.|.    ||.  |.||.|..:..:|.....|.||      
pombe    77 NERISQLHRLFVSWTVSERAEHLKNLLF----DAG--LSNLPLVELGGNVFFNSHVPLP------ 129

  Fly   280 LEFYASTDGCYDRIVKVDSTVVNLRSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKP 344
                     |  .:|...||..||..|...:...:||.|:||.|.||..||..:|.|.|      
pombe   130 ---------C--SLVLTKSTQENLNRITPYLVQKRPILLAGPEGIGKKFLITQIAAKLG------ 177

  Fly   345 NEIESREKALKKAEEEEQLLTPKKKAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTD 409
                            :|:                                    :||.|.|.||
pombe   178 ----------------QQI------------------------------------IRIHLSDSTD 190

  Fly   410 SKMLLGQYRCTDVPGEFVWLPGVLTQAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFR 474
            .|||:|.| .:..||||.|.||||||||:.|.|:|..:::.|..:..::|..|||::.|.:|...
pombe   191 PKMLIGTY-TSPKPGEFEWQPGVLTQAVITGKWILFTNIEHAPSEVLSVLLPLLEKRQLVIPSRG 254

  Fly   475 DSVKIEPGFQLFVTVRTNKSASNSSQKSLYSLLDKYLYTINILPLSRNELCKMVSINYPKLSTVA 539
            :::..:..||:|.|         ||.|:  .:|.:.|:.|..|....:|..::||..||.||.:.
pombe   255 ETIYAKGSFQMFAT---------SSMKT--KILGQRLWQILDLTYQPDECVEVVSTLYPVLSIIC 308

  Fly   540 NRIV----DVFLTFSSGNHTSADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDL 600
            ..:.    |:|..||..:..:...:.                               |.:..||.
pombe   309 PTLYSVYKDIFDLFSQRSFLATSKIY-------------------------------RRLCLRDF 342

  Fly   601 VKLCHR---------SNPQFSVTSSECAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRS 656
            .|...|         ......|.|.|....||:.|:|:|.:::|.......::.::..:|.|...
pombe   343 YKFIKRVAFLYHKFMIPSDHVVISQELQDAVFKEAIDMFGAFIPSRDGFDLVVRNVAIELNIPPE 407

  Fly   657 RCEHFANEYKPDVEFGLEH-IKIGRASLLAKSDLNNSENEDISEQDLKRQKLSQQTRRAIGKVSN 720
            :....  .|...|...||| |.|||.||                     :|||  |.|     |.
pombe   408 KALQL--RYSIPVFQNLEHNINIGRCSL---------------------KKLS--TIR-----SC 442

  Fly   721 KRTTFSFTRLASCILERIAVCVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVS 785
            ...:::||..:..:||::|..|..:||:|||||||.|||:::|.||.....|:.|:||:.|::.|
pombe   443 STNSYAFTSSSLGLLEQLAAGVQTNEPLLLVGETGTGKTTTIQLLAGLLGQKVTVINMSQQTESS 507

  Fly   786 DLVGGFKPVELNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINIC--- 847
            |::||:||:..:.:..||...|..:..:||:.:||.:|:.:.:|.....|....::.....|   
pombe   508 DMLGGYKPINASTLGLPLHERFIDIFEQTFSSKKNAKFISMASTSARRFRWKTCLKIWKEACKLS 572

  Fly   848 ------LQVAKNPELKANKLLPRWQTLREKLQKLQMQLDK--------SINISFAFIPGSLVNCI 898
                  .|...||: |..|.|.....||.:..|.:.:::.        |....|:|:.|:||..:
pombe   573 KTVLDGQQPLPNPQ-KRQKRLSNQVELRNQWAKFEKEVEDFEKVLTGGSNGFMFSFVEGALVKAV 636

  Fly   899 SNGDWVLLDEINLASAETLECLSTILEP-EGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKK 962
            .:|.|||||||||||.||||.:..:|.. |..::|.||||.||:..|.:||:|.||||:||:||:
pombe   637 RSGHWVLLDEINLASLETLEPIGQLLSSYESGILLSERGDITPITPHKNFRLFGCMNPSTDVGKR 701

  Fly   963 DLPVGIRNRFTEFFVDELTTDA-DLSLLVSDYLANTGIQRKSV-HNIVQLYKSLRKLS-ELQLND 1024
            :|....|:||||.:|.....:. ||..::..|:.:..|..:.| ..:.:||:..:.|| :..|.|
pombe   702 ELEPSFRSRFTEIYVHSPDQNLDDLLSIIQKYIGSLCIGNEHVIREVAELYQVAKSLSLDGSLVD 766

  Fly  1025 GLGNRPVYSLRTLCRSLRICAR--NLCGSIERNLYESFCLSFLTQLDPNS-----HHVVLLLI-- 1080
            |.|.||.|::|||.|:|.....  .:.| :.|:|||.||:||||.||..|     :|||...:  
pombe   767 GAGQRPHYTVRTLSRTLSYVTEIAPIYG-LRRSLYEGFCMSFLTLLDHTSESLLYNHVVRFTLGE 830

  Fly  1081 -----QNALLSNVKAILSKQLPQLGE--NYLDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLA 1138
                 |||:|        ||:|::.:  :|:.|..||::.|:...:...|||:|..|:|||.::|
pombe   831 LNRDQQNAIL--------KQIPKVPDHSSYIAFCHYWLRRGSFPVEEQEHYIITPFVQKNLLNIA 887

  Fly  1139 RIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFRE 1203
            |..|....|||:|||||:||||:|:|||:::|::.:|||||||||||||||||..|.:|.|:|||
pombe   888 RACSTRMFPILIQGPTSSGKTSMIEYVAKKTGHKFVRINNHEHTDLQEYIGTYVTDDNGSLSFRE 952

  Fly  1204 GVLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGL 1268
            ||||:|:|:|:||:|||||||.||:||||||:|||||||:|.|||.|||.||.|||||||||||:
pombe   953 GVLVEALRNGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQVLVKPHPEFMLFATQNPPGV 1017

  Fly  1269 YGGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIPPTYARKMVQCMTQLQQHRKNT----S 1329
            |.|||.|||||:|||:|:||.|||..||||||.|||.|.|:||.|:||...:|...|:.|    .
pombe  1018 YAGRKHLSRAFRNRFLEIHFDDIPENELETILHKRCKIAPSYAAKIVQVFRELSLRRQTTRIFEQ 1082

  Fly  1330 KQVF-TLRDLFRWGNR----YTHADKSLHDDNRYDWNQHLVEEGYLVLSSKVRSQEE----HELI 1385
            |..| ||||||||..|    |                |.|.|.||::|:.:.|.|::    .|:|
pombe  1083 KNSFATLRDLFRWAFREAVGY----------------QQLAENGYMLLAERARDQKDKLAVQEVI 1131

  Fly  1386 EKTLFANFRKKLDLQTLFDIQTDRESSSMVSRKILDAIRNFKLRD----DIVWTRNMTRMAVVTA 1446
            ||.:    :.|:|...::::.:            ::..::..|::    .:||||.|.|:..:..
pombe  1132 EKVM----KVKIDTDGIYNLDS------------MEIFQDMSLKEGPLSKVVWTRPMIRLFCLVW 1180

  Fly  1447 KALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPCRGKEST---- 1507
            :.|...|||||||.||||||||||:||.....:|.|:|.|..||..|.:|..||.|.:.:.    
pombe  1181 RCLLAKEPVLLVGDTGCGKTTVCQILAECLHKELHIINAHQDTENGDIIGAQRPVRNRSAVNYSL 1245

  Fly  1508 ------------------------------------------------QLFEWADGPLIYAMQEG 1524
                                                            .||||.||.|:.||::|
pombe  1246 HSQLCEKFNVQESLDSIDDLIEKFEKLSSSEKNDNLSNLIERQIIKYRSLFEWHDGALVTAMKQG 1310

  Fly  1525 SYFMADEISLAEDSVLERLNCILEPERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGD 1589
            .:|:.||||||:||||||||.:||..||:.|.|....:       ..:.||.||.|.||||||||
pombe  1311 DFFLLDEISLADDSVLERLNSVLELSRTLTLVEHSNAA-------VSLTAKDGFAFFATMNPGGD 1368

  Fly  1590 FGKKELSPALRNRFTEVWCLPSDNKEDL------------IEIAYNCMRRQKEHENQAINTHKVA 1642
            :|||||||||||||||:|..|..:.||:            ||:|...:...|.|.|         
pombe  1369 YGKKELSPALRNRFTEIWVPPMVDTEDILKIVEGKLHNNKIELARPLVEYAKWHAN--------- 1424

  Fly  1643 EYLVDVVLHIRDTNDKFKF----SVRDILAWANYMVSNAKLSFAEQAIFGLETIFLDALEMLPHE 1703
            |||...|:.|||.....:|    .:.|:    |.::.||           :..:|:|||......
pombe  1425 EYLYTDVISIRDVLSAVEFINACEILDL----NLVLFNA-----------VSMVFIDALGSFTTF 1474

  Fly  1704 SQEQVELLKSNIVKQAIKQASLILQEKFTLEELSEKRGTEVELNE-----CRFGIRPFFI-DVNQ 1762
            |      |.:|:       |||..:.:....:|:|..|:.:..::     .:|....||| |...
pombe  1475 S------LSNNL-------ASLHAERQRCFAKLNELAGSNIMASKSADISIKFSDSSFFIGDFGI 1526

  Fly  1763 ERLTSAKED--FLFDAPTTKQNLFRLLSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRIN 1825
            ....|.:.|  :.....||..|..::|.||.:.||:||||.|||||||::.::....|:|:||||
pombe  1527 PLGDSVESDSTYSLHTDTTLMNASKVLRALQVLKPILLEGSPGVGKTSLITALARETGHQLVRIN 1591

  Fly  1826 LCEHTDLADLFGTDLPAEDNLLESNTAATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQS 1890
            |.:.|||.||||:|:|.|..           :...|.|||.|.|||:: ...|:||||||||.||
pombe  1592 LSDQTDLMDLFGSDVPVEGG-----------EGGQFAWRDAPFLAAMR-NGHWVLLDELNLASQS 1644

  Fly  1891 VLEGLNAVLDHRGEVYIPELNKSFHLAGSTRIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLS 1955
            |||||||.||||.|.|||||:|.|....:.|:||.|||..|||||||||:||:|||:.||:..|.
pombe  1645 VLEGLNACLDHRNEAYIPELDKVFKAHPNFRVFAAQNPQHQGGGRKGLPRSFINRFSVVYVEALK 1709

  Fly  1956 TEDLLHVVTEKYGKYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLD 2020
            .:|::.:....|    .|:|.                              |...::::|..:|.
pombe  1710 EKDMIEIAACNY----HQVNE------------------------------DWRLKIIKFMFRLQ 1740

  Fly  2021 RGV-ASMEFGYKGGPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVY 2084
            ..: ..:.||..|.|:||||||.|||..|| |....|.. .||:.:              ::::.
pombe  1741 DNIEKDISFGSFGSPWEFNLRDTLRWLQLL-NDAPKYTC-VSPADY--------------LEVMV 1789

  Fly  2085 YQRMRCDQDKSYIRNVFSTVFLCDAEYLNQV---SNDVALYWTADKVYLNDVVLSRKQADVLDLV 2146
            ..|||..:|:.....:|..||  |.:|..:.   |.....:.....:.:.||   .:|..:||..
pombe  1790 LHRMRTVEDRVRTCELFKEVF--DIDYEPRTIGFSLSSQCFKVGHSLLVRDV---ERQKTLLDSQ 1849

  Fly  2147 NRQEQSPLLLDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLSNRL-------CNTD 2204
            |       :|.||...|:.:|..::.:.|.:|.|.|.:|||.::..|..::...       .:||
pombe  1850 N-------ILQSQLPVLESVITCINKKWPCILVGDTATGKTCILRLLAAIAGAKIKEMAVNSDTD 1907

  Fly  2205 IIDDSVTGSFQQIDLNR--------------HLEIIYKKV-----ETLVFSCVQRAFVLHTQSEF 2250
            .:|  :.|.::|||::|              ::.|.|:..     ||.:::....:|..|:|:  
pombe  1908 TMD--LIGEYEQIDISRKASELFTDLSQQLLNIVIKYRNFDNIFRETSLYTLTTTSFKTHSQA-- 1968

  Fly  2251 VEQLWNNWSMYNKLAKVTTEAQQHSVLDELKLFSERLGSLGKIIEVLEATPQNCQVRALQQLAEI 2315
                      :..|.||..:      ||:||:....:.|||.|.|           :|.:.|||.
pombe  1969 ----------FTLLQKVVDQ------LDQLKIHETLVHSLGDIHE-----------KARKLLAEF 2006

  Fly  2316 KSQLLLLQTYIKTADSLNTGGSFEWVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGS 2380
                           |.:..|.|||.|..::.:::.|.:.:|::.||||.|||||||.:.|..|.
pombe  2007 ---------------SASPAGRFEWFDGYLLKAVEEGHWFVLDNANLCSPAVLDRLNSLLEHKGV 2056

  Fly  2381 LLIAEKGISAQDS-AEVVYKSTNFRAFLTVDPKNGELSRAMRNRCVELSLSRDTYSVDDLRAFVH 2444
            |::.||  :.:|. .:.:....|||.||||:|..||||||||||.||:.|.::.           
pombe  2057 LIVNEK--TTEDGHPKTIKPHPNFRLFLTVNPVYGELSRAMRNRGVEIFLLKEA----------- 2108

  Fly  2445 EQGVREMEAIDCILRVHKGLSQLTEFNNYSISHLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVY 2509
                                  |||.:...:| |.:.|.:|:|                      
pombe  2109 ----------------------LTEIDKKQMS-LLEPAPISSA---------------------- 2128

  Fly  2510 SANTDLMGYGLSYYQNKLREVVLAQTEVFEEVAVIQEDFLSDVILNSGNLNSLTLIKRQAVALKV 2574
               .|.:...:||.:           .|||.:..|:.|         ||...:      |.|:.:
pombe  2129 ---VDTLASNISYIK-----------YVFETMGKIEID---------GNYMYI------AHAIIL 2164

  Fly  2575 LLDGYTEGKIPQKLLASLFHEMEKLKLDQRNPQKLIRHFLYMLYESSAIGDLELRHLYLQPWLSK 2639
            .|....:.|:.:|:|.:             |||          :..|...|.||.          
pombe  2165 ALFSPRQLKLLRKVLLT-------------NPQ----------FSLSIKADAELL---------- 2196

  Fly  2640 DTAFQELSQNLYNCLQKRSNTDTGT-----LANLPWNRK----LIPRLRDYSTA--ESNSELNPL 2693
             ...:.|.|.:| |....::.|...     :...|...:    ||..:.|:.:.  .|:.||...
pombe  2197 -LTLKNLVQKIY-CADYFNHMDLKASRFMDIYEYPVQLREVVGLIQTINDFQSVILTSHLELPET 2259

  Fly  2694 NLSALLL--ARLVVDIIPVSSVTTVQQMNALQYSQALCKKQVTEKYANHLLANFSSFLEVLHTSL 2756
            ..|.||.  |..::|:        .:::|.|..|.:  ......|.|:.:..|.|||..      
pombe  2260 YASGLLFVSAHEILDL--------TEEVNRLAVSTS--NSTYLLKSASAVYHNVSSFKG------ 2308

  Fly  2757 LEDLETADLDLPQYAHLVTRFHWFNRILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHLL--VP 2819
                     ..|...:|:.:|..|...:|:|...::|.....| :.|.|.|...|...::.  ||
pombe  2309 ---------STPSLWNLLNQFSKFLIEIASANSNIVYKLSYDV-IRHFLKLVVLWKNIYVWTNVP 2363

  Fly  2820 LIELTAKSGCARML-----TIQDRTLKIKKYIEETRRPLNVTCKIYSKQFTQFQPYYQDQQIQRH 2879
            ..:::......:||     |:.::|..::.::.:                               
pombe  2364 DCDISRFYCYTKMLGEWMFTLTEKTKLLESFLPK------------------------------- 2397

  Fly  2880 IELDDLEKLLSVVPSYGNLE-LSSWLKR---WLLLQTDDANKWRSFLRKHTNGFQPKAFEISGSL 2940
               |.|||       :..|: ||:.|..   |        :||.:|:        |:.::     
pombe  2398 ---DSLEK-------FSELQNLSTGLHMQAIW--------DKWHAFV--------PRTYD----- 2431

  Fly  2941 RNETLQSHLQKLQTTLKEAQENSAEIE--------MDLELDLNSIKTLLEAETEESESYIHPDG- 2996
             ..:|.:.:.||.|....|...|..:|        ..|.| ||  |.|:|.|..:..||:...| 
pombe  2432 -QWSLWNTVDKLLTQYVNANIPSISMETTACEVVGTSLSL-LN--KVLVENEVGDIYSYLKILGK 2492

  Fly  2997 ------------IPTNTPKLL--IAALRELFMERLLTGT---LRDDFDEQVNPLYADQLLTLNSN 3044
                        :|.|...|.  :|:|..|.:....|.:   |.|||...:.       :..:|.
pombe  2493 GVNELKSSKQVILPENLVNLFNCLASLDLLHIFIKYTTSSFFLTDDFVRFIR-------VCFHSR 2550

  Fly  3045 LWHCLKTLESANRTEITNAWIELKNEVNELQNYDEFAVL-----LEKIGGGYKGL-RSYQRQYRN 3103
            :...|.||......:.|.|       |..:..|.:|..|     |.:|...:..: .:...:..|
pombe  2551 ISGNLLTLLHGISFDSTKA-------VAPVLTYFDFCSLTTGNILGRIALAFTSIDENANLESAN 2608

  Fly  3104 SVQCYQLENLSTRLDCVQGPSEEGSTDISSQFCYRGPALSGVILSLI-----CQPNGQL---RSV 3160
            ..:..:|..|...:|.....:|:.||.::.....|    ..||:|:.     |:....|   .|:
pombe  2609 IFEHARLALLQHFMDHSSLLAEDSSTKMNLILLQR----YAVIISIFLDQGKCEKANDLITKLSL 2669

  Fly  3161 PLSELLE-WRSALQQTRHLIWENSQLLTSRYSGEVNNLLQAKENARQLLKELEYVRK--LSEKEQ 3222
            |..||.| :.|.|:..:..:..||:.::..|:             .:.:..|.:::.  ||..:|
pombe  2670 PYEELAENFVSILEACKAFLVANSEFISYTYT-------------ERFIHSLRFLKDSWLSSNQQ 2721

  Fly  3223 K--ANQG-------------------FENC------AKELEKMIEKLEKEENNNASMTKDFEVSL 3260
            |  .|||                   |:..      .:.|...:|.|.||     |...:...||
pombe  2722 KMLKNQGMAYIYFASGMLLVYVPDKPFDPALLPLLTVESLRHYLESLYKE-----SQILEIAESL 2781

  Fly  3261 TNALVGAIELCL----LTNTPLIDPVEKNRLKNEYIAEDIDCLSTLTTAYDFMKIAMKYRHFGEE 3321
            .:..|.::...|    ::|||.||                   |:.:|.         ||...|.
pombe  2782 NSGKVNSVMRRLVSTEISNTPNID-------------------SSFSTV---------YRSLNES 2818

  Fly  3322 I---YSELELRLRTALQRQQQLSQKLALRSEKCLYASLVQDITHFLHSNGDCESLYKLFQLIHSE 3383
            |   |||||..:::.:..|...  :||:|..|....::|::...|:                 ::
pombe  2819 IVPLYSELEFFMKSVVLNQYIF--ELAMRLSKESNIAVVEEAKSFV-----------------TK 2864

  Fly  3384 WENFQGLHVATSAQLKSSIEVLGKLDLWLANAQRFVHHTLSRYSAYYQDFV---EPIKCSVNQLR 3445
            |:.:                                   :.|....|..||   |.|...::.:.
pombe  2865 WKAY-----------------------------------IERIREAYPQFVDVYELILSFISFMI 2894

  Fly  3446 FGLESLKVIFTRVQQAGSVSQAEQMQQTIGDIVQFPSQHPLVIRNSRLYGLLAEL--PHSEYEYF 3508
            :|:|                           ::.|.::..|..|:..|..|:..|  |.|   :.
pombe  2895 YGIE---------------------------LLMFEAKRRLDERSQILSTLILTLVDPSS---FA 2929

  Fly  3509 RLLKAKLSELSNYIALGRVIDETTFAAYDDALSICNQTWQQEEHRRCQLKAEAESLYVTKTKGGV 3573
            |.|  ...::||.|...:|:|......::..|.:.::...:::|     .::..||        .
pombe  2930 RSL--SFDDVSNLIEQIKVLDLNDSIRFEIYLFLASRLCSEKQH-----SSDTHSL--------A 2979

  Fly  3574 DSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASAKDKQSQIVVEEDYAFLARNFI 3638
            :|..|:..:...||..          :.|..||::          ::::::..:.::.|...:::
pombe  2980 NSFVLLANEFYIHNAK----------IKQKELEEI----------EEKNRLYRQREFNFDKNDYL 3024

  Fly  3639 DVMTRHTQVYYKEQPKSSKELELHLLAPYQARFQVFANLHGHYKTALG-SSLEERACNGLAFGLA 3702
            .|...:..   :.:|:...|:.:......|.:|..::..:..|...:. ..||:....|......
pombe  3025 KVFINYDD---EVEPEVEPEVVIERKRFLQLQFAFWSLYNEIYSEKMNVIPLEQLMNTGSYLAKK 3086

  Fly  3703 LQQK----------QLRDIELEEGVSSS---------PYDFYKDSNISEIQSCLDVMERIEKRVL 3748
            ::.|          .:..:.|..||.|:         .|:||.|.|.|:.....|:::.:|.|.:
pombe  3087 IKVKNPDMIASSGFDIVSVVLMMGVKSTNERQYWTPPVYNFYSDPNPSKAIEVRDLIKIVESRAI 3151

  Fly  3749 EQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLALWNEVAHRNNNLVSEEIEV 3813
            ..::.:||:..|..:|..|..|..|...:|:..:.:..:.:...|:.|.::|.|..:|.:|...:
pombe  3152 SLIKNWPENFVLRGLKDAIDAILNLSPFSPIAEYLSKLERVFHLLSEWEKLASREYSLANEMDLI 3216

  Fly  3814 AEFVQRWTRLELQHWRNCLGQTAAQVELQAY----RYWFFIYNLLQQFIHQKQLDHSYTDIKLAE 3874
            .:.:..|.:.||.:|.|.|       :|:.|    |.:..:|::||..|.:...::|        
pombe  3217 KKKIIDWRKFELSNWNNLL-------KLEEYKLSERVYPRLYSILQFIILKPFFENS-------- 3266

  Fly  3875 QRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQGFELYLHNVERAGKIN 3939
             :|.:.:|.::              ..|:.||:.....|:|.:.|:.|..|.      :.|..:.
pombe  3267 -KFTKQNLCES--------------ASIIVQFITDLTVGEFQLCLKCLLSFS------QHAASLR 3310

  Fly  3940 GLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKDLSYFSMRNSVASVHR 4004
            ....:.|.|.|:..||.||..:::::...::..:|..:||.:.:.|: ||.:.::::.|....|.
pombe  3311 ICHGIDAMLLNIYHYFEQFLSKVSEAIHTQKQSLENSIKERILLMSW-KDTNVYALKESAKKSHA 3374

  Fly  4005 NLNKFLKEYRLSIQEKISEVFQPKDSTAKDYTFGTDKGKGLRNYNKIKYLHTERQQFVASEKLLE 4069
            .|.|.|..||..:::.:|.....|...  |....|:....:....|:.          .|...:|
pombe  3375 ELFKVLHRYREVLRQPVSSYLSQKHDW--DSLLDTENNSAMWVAKKVN----------LSPSYIE 3427

  Fly  4070 KF------AIQEEFLSDNTLLQ-------RLDKHFRTARHVVKETLGQVPYGELITELDDLLASQ 4121
            |.      .:...|.:..|.|:       .::|...|..::|         ..|||:..:|:...
pombe  3428 KMDTEIMKLVPVRFSNTPTTLRLMWTLFANVEKPGSTFTNMV---------SNLITDARELMKLT 3483

  Fly  4122 LERCEHLRSLNVDRSKERPQQKQEAKQILQQKRKALTDLFKMLHRLGANY--KTGLLE--LSLRN 4182
            .|      ::|.|       ...|.|.:..:|...||:.||.|...|..|  |.|:.|  .:|||
pombe  3484 PE------TINDD-------NLSEIKHLKSRKHLLLTETFKTLKAFGLQYRVKAGIEENLSNLRN 3535

  Fly  4183 EFEDFQLPPYSIRSMLPRLHPTAQQLDEHLDLYYMKSVFKLKLLQNIMLTPLSELGPPNIERIKG 4247
                       :.:::|....|:..: |.:|...|||:..:...|.:.....::|..|.:::..|
pombe  3536 -----------LLAVIPTFPVTSLSI-EKVDRSLMKSLDFIPKFQTLAGHQHNDLSVPEVQKGVG 3588

  Fly  4248 FAVDLFLLVQQQREHLSGSTKELHELRNSLDSLRKLAEIIPQADINPSTLNFVKSADIAMEIKQH 4312
            ....:..|...:|..|...|.||..|:|....:.....  |....|.|:.|.|.|.....:.:..
pombe  3589 LFNSMLSLQLGERAQLVEFTNELLALKNVYSEVGVNGS--PLESFNNSSFNEVSSLGYDHDFENR 3651

  Fly  4313 LRQIHYVLKQWKLLL----SCAP-SSFIEESENRLLVRKISLAQSELHSLCIQILNSSQELLNEL 4372
            .:.:..:.:.:.:::    |.:| :||  :|....|.|...|..::|....|.:           
pombe  3652 AQAVSMLCQIYAIVIQKHSSISPTASF--QSIGHELSRFADLLSNKLFPSSIPL----------- 3703

  Fly  4373 NNANLEYLSSEKCVTYQKSYAEIQENIKKTLELLRTGQNDYLPLAQPIVELLDSVQLKNHTEIAP 4437
                  |.|::|.    .|..:.|:.|...:|..|..:.:...|:.....|:....||:   |:.
pombe  3704 ------YASADKV----SSIRDQQKGINDLIEYCRKKRTELPELSYCFKHLVSLQSLKS---ISR 3755

  Fly  4438 EAIDLANAD-----TELANIAHSVLMSMQKIYKHHVKTDEVNQNGEAKEQDEESKEALQEQHLKK 4497
            ..:||.|.:     ..:.|:..|:|.|::...|:.....|:.:.....|......:.|:..:|| 
pombe  3756 TQVDLTNDEFLNLMNFVLNLFDSLLSSIETATKNMRTFKELAETSSFIEMSSCFSKVLRAFNLK- 3819

  Fly  4498 CLTGELTSDWQQLSLPRVLGKLSNVLLVLKHSHFEGKDKLLCVRRAIGLLPVLEQYQLLADYLLL 4562
                     :|.:.|..:..||.:          ...||:.| :..:..|||.||:..||:.:|.
pombe  3820 ---------FQSMKLSSLKEKLRS----------SSVDKMSC-QLLMLFLPVCEQFINLAESVLD 3864

  Fly  4563 QQLATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKNGE---GFGLEDGTGEND 4624
            ..:..|..:...||.:.|:|..:.:.||| .|||.|  ||    :|.:||   |.||..|.|..|
pombe  3865 YFINVHNSNLDSLSKISTLFFMVANNGFC-SPDLPQ--EG----KSNSGELESGTGLGSGVGAED 3922

  Fly  4625 ASDKIESEDQLDDAKRPEDRKDEGDKQEPDCKEEKGIEMSDDFDAKMQDVEKPEEDDSGESEEEE 4689
            .::.:..:|.|::....||..::.|..|.:.:     |:..|.:...:|....|.::|...||.:
pombe  3923 ITNTLNEDDDLEELANEEDTANQSDLDESEAR-----ELESDMNGVTKDSVVSENENSDSEEENQ 3982

  Fly  4690 DLNKEMGE-TEEGAEKLDDQIWGDDEEEKPEEEQEPDMNEEDQGKGSKDEKDAHNDLDTKND--A 4751
            ||::|:.: .|:.:..|::::|     ::|.||   |:.|.:|....:...:..:||.:|.|  .
pombe  3983 DLDEEVNDIPEDLSNSLNEKLW-----DEPNEE---DLLETEQKSNEQSAANNESDLVSKEDDNK 4039

  Fly  4752 AKEDGKDEHEKDGLDATNEPSGEDKRKEQAKDIDDMKDPEMDEEQTNAMHNELEEPPE------- 4809
            |.|| ||..||:..:..::..|          |||...|::.|       |..:.|||       
pombe  4040 ALED-KDRQEKEDEEEMSDDVG----------IDDEIQPDIQE-------NNSQPPPENEDHLDL 4086

  Fly  4810 PEEMDL----GDMNNVDEGHDDQDEQPTDENPFDIDAMK-ENMQPAEEPEADGDDEHDANEEGDP 4869
            ||::.|    ||::. |...:|.|.:..|||..:.||.| |.||..|:|.    :|::..:|...
pombe  4087 PEDLKLDEKEGDVSK-DSDLEDMDMEAADENKEEADAEKDEPMQDFEDPL----EENNTLDEDIQ 4146

  Fly  4870 QSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEK 4934
            |.|.||..||:........||:..|.||:|.:..|.:.|.: :||:           |||...:.
pombe  4147 QDDFSDLAEDDEKMNEDGFEENVQENEESTEDGVKSDEELE-QGEV-----------PEDQAIDN 4199

  Fly  4935 EEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGV 4999
            ..|.:.|                     .|..|:.||            ::..|:...||.:: :
pombe  4200 HPKMDAK---------------------STFASAEAD------------EENTDKGIVGENEE-L 4230

  Fly  5000 GQAENDADDGGH-QGVAETQETVSQEDRKNERQTQEKRKQGRTNEE-RSLGEAEQNKLKQLKTID 5062
            |:.:..|:.|.. .|.|:.:.:.:::.:|.|..:..|......:.: :|||:       .|:...
pombe  4231 GEEDGAAESGVRGNGTADGEFSSAEQVQKGEDTSTPKEAMSEADRQYQSLGD-------HLREWQ 4288

  Fly  5063 QLKDSKESDDAEQEKPEPMDQTEAEEYQHVKEPKNSDKTTLDNATEEQSKKIQHQEDEPPNEEEI 5127
            |.....|.:|..:.:.:..|.:   |:.||||.:..|...|.||.::|.|.|...|....|.:.:
pombe  4289 QANRIHEWEDLTESQSQAFDDS---EFMHVKEDEEEDLQALGNAEKDQIKSIDRDESANQNPDSM 4350

  Fly  5128 EAENV--DELME-AEEPAVDPEDDAELEQLGAEKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVV 5189
            .:.|:  ||..| .::...|.:|.::::|.|.:....:....:::||   ..|..|..:||.|: 
pombe  4351 NSTNIAEDEADEVGDKQLQDGQDISDIKQTGEDTLPTEFGSINQSEK---VFELSEDEDIEDEL- 4411

  Fly  5190 LTMTVPRSSETTAHSNSEILLDKSSHAEDLSSAEQIELRQQYQKQLTTFRVAQPEHEDYETWQGI 5254
                                                   ..|..::|....|.|..|..:.|...
pombe  4412 ---------------------------------------PDYNVKITNLPAAMPIDEARDLWNKH 4437

  Fly  5255 SNRMTQNARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQR 5319
            .:...|.:.|||||||||||||..|:::||:|||:|:|||:|||||||||:|||||:||.||::|
pombe  4438 EDSTKQLSIELCEQLRLILEPTLATKMQGDFRTGKRLNMKRIIPYIASQFKKDKIWMRRVKPSKR 4502

  Fly  5320 DYKITIAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQIILNHTEQF---D 5381
            .|::.|:|||||||..:.|..|.||.::||::||:|||.|:::::.|||.|:::....:||   .
pombe  4503 TYQVMISIDDSKSMSESGSTVLALETLALVTKALSLLEVGQIAVMKFGEQPELLHPFDKQFSSES 4567

  Fly  5382 GPRLVNALNFAQDKTKIAGL-------LNFIRTANAEESGTGGDNGLFENLLLILSDGRNIFSEG 5439
            |.::.:...|.|..|.:..|       .|:..||:...|     |.....|.:|:|||   ..|.
pombe  4568 GVQMFSHFTFEQSNTNVLALADASMKCFNYANTASHHRS-----NSDIRQLEIIISDG---ICED 4624

  Fly  5440 AQNVKNAIKLARLQRIFLVYIIID--NPDNKNSILDIQHVAVNA--DGSVN--INSYLDSFPFPY 5498
            ..:::..::.|:.:::.:|::|:|  |...|:|||||:.|..:.  ||:::  |..|:|.|.|.|
pombe  4625 HDSIRKLLRRAQEEKVMIVFVILDNVNTQKKSSILDIKKVYYDTKEDGTMDLKIQPYIDEFAFDY 4689

  Fly  5499 YVIVRDLNQLPLVLSEAMRQWFELVNS 5525
            |::||::.:||.:||.|:||||:.:::
pombe  4690 YLVVRNIEELPQLLSSALRQWFQQMSN 4716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1505/5594 (27%)
P-loop_NTPase 315..505 CDD:304359 55/190 (29%)
P-loop_NTPase <887..972 CDD:304359 45/86 (52%)
P-loop_NTPase 1147..1283 CDD:304359 102/136 (75%)
P-loop_NTPase 1454..1603 CDD:304359 85/201 (42%)
P-loop_NTPase 1795..1946 CDD:304359 86/151 (57%)
P-loop_NTPase <2335..>2378 CDD:304359 19/43 (44%)
Prothymosin 4843..4920 CDD:281265 24/78 (31%)
PHA03151 4856..5060 CDD:177546 42/206 (20%)
MttA_Hcf106 <5046..5166 CDD:294511 30/123 (24%)
vWA_midasin 5261..5526 CDD:238737 117/282 (41%)
SPCC737.08NP_588370.1 MDN1 1..4717 CDD:227596 1525/5683 (27%)
P-loop_NTPase 154..269 CDD:304359 52/183 (28%)
P-loop_NTPase <625..711 CDD:304359 45/86 (52%)
P-loop_NTPase 896..1032 CDD:304359 102/136 (75%)
P-loop_NTPase 1188..1382 CDD:304359 85/201 (42%)
P-loop_NTPase 1561..1700 CDD:304359 86/151 (57%)
P-loop_NTPase <2010..2098 CDD:304359 41/90 (46%)
ASF1_hist_chap <4038..4196 CDD:304562 57/193 (30%)
vWA_midasin 4444..4717 CDD:238737 117/282 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1576 1.000 Inparanoid score I9
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 1 1.000 T1124277
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R702
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.