DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and MDN1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_055426.1 Gene:MDN1 HGNCID:18302 Length:5596 Species:Homo sapiens

Alignment Length:6141 Identity:1938/6142 (32%)
Similarity:2954/6142 (48%) Gaps:1170/6142 (19%)


  Fly     1 MEVNVSKLRLGAQRLLELTANESEDNVFSQSLQKFIKKQKYVPQDVERLFRSLSEQLPLPAYTVP 65
            :||..:.|||.|.:      ||..    ...|.:|:.||.:.|||.:.:..:|::.|.....||.
Human     6 LEVAAAPLRLIAAK------NEKS----RSELGRFLAKQVWTPQDRQCVLSTLAQLLLDKDCTVL 60

  Fly    66 IAASFEEQLLLLL---SMALRWDSASQRFH-TYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPF 126
            :.......||.||   :.|::  :..|..| .::..||::|||:....|...||..||.|....|
Human    61 VGRQLRPLLLDLLERNAEAIK--AGGQINHDLHERLCVSMSKLIGNHPDVLPFALRYFKDTSPVF 123

  Fly   127 EK--QQSNGSLPSKKSKNGNHAADNLDDLELIKCCFQLLKSDTPYFRELWDWS----------SF 179
            ::  .:|:.:.|.:..:......|      |::..|:.|:.:...||||||||          :.
Human   124 QRLFLESSDANPVRYGRRRMKLRD------LMEAAFKFLQQEQSVFRELWDWSVCVPLLRSHDTL 182

  Fly   180 IATYTHNSSSPKTQLYCNYIVAMLTNMSAPQLNSLNEKISTKTRL-EFD---------QEREQAW 234
            :..||.|         |   :|::|.|:.....|..:||.....| .|.         |:.|:|.
Human   183 VRWYTAN---------C---LALVTCMNEEHKLSFLKKIFNSDELIHFRLRLLEEAQLQDLEKAL 235

  Fly   235 NTARNTLCSYTPDASDQLLNLHL--HGINKSVTNIEGVLLP--------------TFNEENLEFY 283
            ..|...:..:......|.|..||  ..::..||.:.||:||              :..|:.|...
Human   236 VLANPEVSLWRKQKELQYLQGHLVSSDLSPRVTAVCGVVLPGQLPAPGELGGNRSSSREQELALR 300

  Fly   284 ASTDGCYDRIVKVDSTVVNLRSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIE 348
            :        .|.|:|...:|:::|:.||:...:.|.||:|||||:|:||||..|||         
Human   301 S--------YVLVESVCKSLQTLAMAVASQNAVLLEGPIGCGKTSLVEYLAAVTGR--------- 348

  Fly   349 SREKALKKAEEEEQLLTPKKKAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKML 413
                                                         ||....|::|||||||||||
Human   349 ---------------------------------------------TKPPQLLKVQLGDQTDSKML 368

  Fly   414 LGQYRCTDVPGEFVWLPGVLTQAVMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVK 478
            ||.||||||||||||.||.||||...|:|:||||:|.|..|..::|..|||...|.:||..|.:|
Human   369 LGMYRCTDVPGEFVWQPGTLTQAATMGHWILLEDIDYAPLDVVSVLIPLLENGELLIPGRGDCLK 433

  Fly   479 IEPGFQLFVTVRTNKSASN--SSQKSLYSLLDKYLYTINILPLSRNELCKMVSINYPKLSTVANR 541
            :.||||.|.|.|......|  ....|..:|||||...|::..|.:.||.:::...||.|..|.:.
Human   434 VAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTKIHLDNLDKRELNEVLQSRYPSLLAVVDH 498

  Fly   542 IVDVFLTFSSGNHTSADNLRQQESGDKADNTEQYVALPFEQVPLTSSPN-----SGRLVSTRDLV 601
            ::|:::..:...|.|        ..|.:...||   .| |:|......|     .||.:|.|||:
Human   499 LLDIYIQLTGEKHHS--------WSDSSVGCEQ---AP-EEVSEARRENKRPTLEGRELSLRDLL 551

  Fly   602 KLCHRSNPQFSVTSSECAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYK 666
            ..|:|....|..:|...:..:||.|:|.|.:.|.:...|:.:...||:||.|.|.:.|.|...||
Human   552 NWCNRIAHSFDSSSLSASLNIFQEALDCFTAMLSEHTSKLKMAEVIGSKLNISRKKAEFFCQLYK 616

  Fly   667 PDVEFGLEHIKIGRASLLAKSDLNNSENEDISEQDLKRQKLSQQTRRAIGKVSNKRTTFSFTRLA 731
            |::......:::||..||.|      ::|.:   .|:|:|.                ||:.||.:
Human   617 PEIVINELDLQVGRVRLLRK------QSEAV---HLQREKF----------------TFAATRPS 656

  Fly   732 SCILERIAVCVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVEL 796
            |.::|::||||:..||||||||||.||||::||||..|.|:|.|||||.|||.:||:||:|||:.
Human   657 SVLIEQLAVCVSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVDH 721

  Fly   797 NYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPELKANK- 860
            ..:..|||..||.|..:||::::|..||....|.|...|...::|.|.:: .:.|.|.:.|.:: 
Human   722 KLIWLPLREAFEELFAQTFSKKQNFTFLGHIQTCYRQKRWHDLLRLMQHV-HKSAVNKDGKDSET 785

  Fly   861 ---LLPRWQTLREKLQKLQMQLDKSIN-ISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLS 921
               :..:|:....:|...|.|:..:.| :.|||:.|:|...:..|:|:||||||||:.|.|||||
Human   786 GLLIKEKWEAFGLRLNHAQQQMKMTENTLLFAFVEGTLAQAVKKGEWILLDEINLAAPEILECLS 850

  Fly   922 TILE-PEGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNRFTEFFVDELTTDAD 985
            .:|| ..||:|||:|||..|:.||||||:||||||.||:||::||.||||||||.:|:||.:..|
Human   851 GLLEGSSGSLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRNRFTELYVEELESKED 915

  Fly   986 LSLLVSDYLANTGIQRKSVHNIVQLYKSLRKLSELQLNDGLGNRPVYSLRTLCRSLRICARNLCG 1050
            |.:|:.|||....:.:.:|..|:..|.:|||.|..:|.||.|:||.||||||||:||..|.|.||
Human   916 LQVLIVDYLKGLSVNKNTVQGIINFYTALRKESGTKLVDGTGHRPHYSLRTLCRALRFAASNPCG 980

  Fly  1051 SIERNLYESFCLSFLTQLDPNSHHVVLLLI-QNALLSNVKAILSKQLPQ-LGENYLDFEGYWIQP 1113
            :|:|:|||.|||.||||||..||.:|..|| |:.:..|||::|.:.:|: .|...:..|||||..
Human   981 NIQRSLYEGFCLGFLTQLDRASHPIVQKLICQHIVPGNVKSLLKQPIPEPKGGRLIQVEGYWIAV 1045

  Fly  1114 GNLEPQPCTHYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINN 1178
            |:.||.....||||.|||.||:|:.|::|.|..|:|:||.||.||||||.::|..:||.|:||||
Human  1046 GDKEPTIDETYILTSSVKLNLRDIVRVVSAGTYPVLIQGETSVGKTSLIQWLAAATGNHCVRINN 1110

  Fly  1179 HEHTDLQEYIGTYAADLDGKLTFREGVLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELY 1243
            |||||:|||||.|.:|..|||.|:||||:.|||.|:||||||||||.||:||||||:|||||||.
Human  1111 HEHTDIQEYIGCYTSDSSGKLVFKEGVLIDAMRKGYWIILDELNLAPTDVLEALNRLLDDNRELL 1175

  Fly  1244 IAETQTLVKAHPNFMLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIPP 1308
            :.|||.:|||||.|||||||||||||||||.|||||:|||:||||.::|..||||||.|||.:||
Human  1176 VTETQEVVKAHPRFMLFATQNPPGLYGGRKVLSRAFRNRFVELHFDELPSSELETILHKRCSLPP 1240

  Fly  1309 TYARKMVQCMTQLQQHRKNTS----KQVF-TLRDLFRWGNRYTHADKSLHDDNRYDWNQHLVEEG 1368
            :|..|:|:.|..||.:|:::|    ||.| ||||||||..||..|:.:   :..|||.|||..:|
Human  1241 SYCSKLVKVMLDLQSYRRSSSVFAGKQGFITLRDLFRWAERYRLAEPT---EKEYDWLQHLANDG 1302

  Fly  1369 YLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFDIQTDRESSSMVSRKILDAIRNFKLRDDIV 1433
            |::|:.:||.|||.::|::.|..:|:|||..|:||..:...:....:|.:|.....||   ..||
Human  1303 YMLLAGRVRKQEEIDVIQEVLEKHFKKKLCPQSLFSKENVLKLLGKLSTQISTLECNF---GHIV 1364

  Fly  1434 WTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGL 1498
            ||..|.|:|::..:||||.|||||||.|||||||:||:.|::|:.:|..::||:|.|.:||||||
Human  1365 WTEGMRRLAMLVGRALEFGEPVLLVGDTGCGKTTICQVFAALANQKLYSVSCHLHMETSDFLGGL 1429

  Fly  1499 RPCRGK-------ESTQLFEWADGPLIYAMQEGSYFMADEISLAEDSVLERLNCILEPERTVLLA 1556
            ||.|.|       ::::||||.||||:.||:|..:|:.||||||:||||||||.:||.|::::||
Human  1430 RPVRQKPNDKEEIDTSRLFEWHDGPLVQAMKEDGFFLLDEISLADDSVLERLNSVLEVEKSLVLA 1494

  Fly  1557 EKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELSPALRNRFTEVWCLPSDNKEDLIE-I 1620
            |||...:.|:..:.:...|. |:.|||||||||||||||||||||||||:||..|.::||||: |
Human  1495 EKGSPEDKDSEIELLTAGKK-FRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTSREDLIQII 1558

  Fly  1621 AYN-----CMRRQKEHENQAINTHKVAEYLVDVV--LHIRDTNDKFKFSVRDILAWANYM-VSNA 1677
            ::|     |:.|.....:.      :.|.::|.:  |..::...|...|:||||:|.|:| ....
Human  1559 SHNLRPGLCLGRIDPKGSD------IPEVMLDFIDWLTHQEFGRKCVVSIRDILSWVNFMNKMGE 1617

  Fly  1678 KLSFAEQAIFGLETIFLDALEMLPHESQEQVELLKSNIVKQAIKQASLILQE--KFTLEELSE-K 1739
            :.:.....|....|.|:.|..::      .::.:.|.:.......|.|..:|  ||.::.|:: .
Human  1618 EAALKRPEIISTVTSFVHAACLV------YIDGIGSGVTSSGFGTALLARKECLKFLIKRLAKIV 1676

  Fly  1740 RGTEVELNECR----------------FGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLFRLLS 1788
            |.||.:.||.:                :||.||||........:...|:...|.||..|..|||.
Human  1677 RLTEYQKNELKIYDRMKAKEFTGIDNLWGIHPFFIPRGPVLHRNNIADYALSAGTTAMNAQRLLR 1741

  Fly  1789 ALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAA 1853
            |..|:||:||||.|||||||:|.::..|.|..:|||||.|.||:.||||.|||.|..        
Human  1742 ATKLKKPILLEGSPGVGKTSLVGALAKASGNTLVRINLSEQTDITDLFGADLPVEGG-------- 1798

  Fly  1854 TERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKSFHLA- 1917
               :...|.||||||||||||.: |::|||||||.|||||||||..|||||:|:|||..||.:. 
Human  1799 ---KGGEFAWRDGPLLAALKAGH-WVVLDELNLASQSVLEGLNACFDHRGEIYVPELGMSFQVQH 1859

  Fly  1918 GSTRIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLNAYFLELL 1982
            ..|:||.||||.:|||||||||:|||||||:|::..|:..|:                .:....|
Human  1860 EKTKIFGCQNPFRQGGGRKGLPRSFLNRFTQVFVDPLTVIDM----------------EFIASTL 1908

  Fly  1983 DQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGV-ASMEFGYKGGPYEFNLRDILRWC 2046
            ....|.|:.:                  ::|.|:.|:|..| ...::|.||||:||||||:.|||
Human  1909 FPAIEKNIVK------------------KMVAFNNQIDHEVTVEKKWGQKGGPWEFNLRDLFRWC 1955

  Fly  2047 DLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSYIRNVFSTVFLCDAE- 2110
            .|:       ::..||..:...         :.:.|||.:|||.::||..:..||..||..::. 
Human  1956 QLM-------LVDQSPGCYDPG---------QHVFLVYGERMRTEEDKKKVIAVFKDVFGSNSNP 2004

  Fly  2111 YLNQVSNDVALYWTADKVYLNDVVLSRKQADVLDLVNRQEQSPLLLDSQR-QQLKQIIETVHMEK 2174
            |:......:..|    .|.|...||||...     |....:.||||..|. |.|:.|::.|.|..
Human  2005 YMGTRLFRITPY----DVQLGYSVLSRGSC-----VPHPSRHPLLLLHQSFQPLESIMKCVQMSW 2060

  Fly  2175 PLLLCGSTDSGKTKLIDALCVLSNR-----LCNTDIIDDSVTGSFQQIDLNRHLEIIYKKVETLV 2234
            .::|.|....|||.|:..|..|:..     ..|:.:....:.|.|:|:||.|....:.:|||..|
Human  2061 MVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSAMDTTELLGGFEQVDLIRPWRRLLEKVEGTV 2125

  Fly  2235 FSCVQRAFVLHT-QSEFVEQLWNNWSMYNKLAKVTTEAQQHSVLDELKLFSERLGSLGKIIEVLE 2298
            .:.::.:.::.. .:|.|.:.|:::.:..|                    .:.||..||.|    
Human  2126 RALLRDSLLISADDAEVVLRAWSHFLLTYK--------------------PKCLGEGGKAI---- 2166

  Fly  2299 ATPQNCQVRALQQLAEIKSQLLLLQ-------TYIKT---------------ADSLNTG---GSF 2338
                     .::.:.::::.|||:|       :|.|.               ...|.:|   |:|
Human  2167 ---------TMEIVNKLEAVLLLMQRLNNKINSYCKAEFAKLVEEFRSFGVKLTQLASGHSHGTF 2222

  Fly  2339 EWVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYKSTNF 2403
            |||||.:|.:||.|.::|:::||.|:.:||||||.:.||.|.|.|:|:|: ...|...:..:.||
Human  2223 EWVDSMLVQALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTISERGM-IDGSTPTITPNPNF 2286

  Fly  2404 RAFLTVDPKNGELSRAMRNRCVELSLS--RDTYSVD--DLRAFVHEQGVREMEAIDCILRVH-KG 2463
            |.||::||.:|::|||||||.:|:.:|  .|..:.|  ||:..:|..|:......|.:|.:| :.
Human  2287 RLFLSMDPVHGDISRAMRNRGLEIYISGEGDASTPDNLDLKVLLHSLGLVGNSVCDILLALHTET 2351

  Fly  2464 LSQLTEFNNYSISHLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVYS----ANTDLMGYGLSYYQ 2524
            .|.:......|:|.|.|.|.|...|.:.|..|.||...|..||||.|    ||..|:...|..:.
Human  2352 RSTVVGSPTSSVSTLIQTAILIVQYLQRGLSLDRAFSEACWEVYVCSQHSPANRKLVQALLEKHV 2416

  Fly  2525 NKLR------EVVLAQ----TEVFEEVAVIQEDFLSDV---------ILNSGNLNSLTLIKRQAV 2570
            :.||      :.:|..    ..|...:...::..||.|         .||..::.:.:..:.|..
Human  2417 SSLRAHETWGDSILGMGLWPDSVPSALFATEDSHLSTVRRDGQILVYCLNRMSMKTSSWTRSQPF 2481

  Fly  2571 ALKVLLDGYTEGKIPQKLLASLFHEME----------------KLKLDQ-RNPQKLIR-HFLYML 2617
            .|:. |:...:...|:.|   .|:.:|                ||.::: .|...::| .:||.|
Human  2482 TLQD-LEKIMQSPSPENL---KFNAVEVNTYWIDEPDVLVMAVKLLIERATNQDWMLRVKWLYHL 2542

  Fly  2618 YESSAIGDLELRHLYLQPWLSKDTAFQELS-----QNLYNCLQKRSNTDTGTLANLP-WNRKLIP 2676
            .::...| ||...::|:...:....|...|     .|::..||. :.||...:...| ||.:.:.
Human  2543 AKNIPQG-LESIQIHLEASAASLRNFYSHSLSGAVSNVFKILQP-NTTDEFVIPLDPRWNMQALD 2605

  Fly  2677 RLRDYSTAESNSELNPLNLSALLLARLVVDIIPVSSVTTV-QQMNALQYSQALCKKQV------- 2733
            .:|:....:..:: .|..|.|||.:.....||.:.....| .:.|.:.......::.|       
Human  2606 MIRNLMDFDPQTD-QPDQLFALLESAANKTIIYLDREKRVFTEANLVSVGSKKLRESVLRMSFEF 2669

  Fly  2734 ---TEKY---ANHLLANFSSFLEVLHTSLLEDLETAD--LDLPQYAHLVTRFHWFNRILATAQQK 2790
               .|.|   .:.::.|.::|.|:....:|..::::.  :.......::....|.:|....|.  
Human  2670 HQDPESYHTLPHEIVVNLAAFFELCDALVLLWVQSSQGMVSDASANEILGSLRWRDRFWTVAD-- 2732

  Fly  2791 LLYNNELHVPLMHKLVLHFQWLEKHLLVPLIELTAKSGCARMLTIQDRTLK-------------- 2841
               ..::..|.:..|.||:.|:.|||:..:..|        ::..:|:..|              
Human  2733 ---TVKVDAPGLALLALHWHWVLKHLVHQIPRL--------LMNYEDKYYKEVQTVSEHIQNCLG 2786

  Fly  2842 --------IKKYIEETRRPLNVTCKIYSKQFTQFQPYYQDQQIQRHIELDDLEKLLSVVPSYGNL 2898
                    |||..:...||.....|:..:.|:|               |..|.|:|::......|
Human  2787 SQTGGFAGIKKLQKFLGRPFPFKDKLVVECFSQ---------------LKVLNKVLAIREQMSAL 2836

  Fly  2899 ELSSWLKRWLLLQTDDANKWRSFLRKHTNGFQPKAFEISGSLRNETLQSHLQKLQTTLKEAQENS 2963
            ..|.|.:....||. .|::|                    :|:...||:....|:..:.|     
Human  2837 GESGWQEDINRLQV-VASQW--------------------TLKKSLLQAWGLILRANILE----- 2875

  Fly  2964 AEIEMD----------LELDLNSIKT-LLEAETEESESYIHPD---GIPTNTPKLLIAALREL-- 3012
             ::.:|          |||....:.. .||.:.:|:.|..|||   .|.......|..|:..|  
Human  2876 -DVSLDELKNFVHAQCLELKAKGLSLGFLEKKHDEASSLSHPDLTSVIHLTRSVQLWPAMEYLAM 2939

  Fly  3013 ---------FMERLLTGTLRDDFDEQVN--------------PLYADQLLTLNSNLWHCLKTLES 3054
                     ||.:........:...|:|              |:...:|..|.|.|.|     :.
Human  2940 LWRYKVTADFMAQACLRRCSKNQQPQINEEISHLISFCLYHTPVTPQELRDLWSLLHH-----QK 2999

  Fly  3055 ANRTEITNAWIELKNEV------NELQNYDEFAVLLEKIGGGYKGLRSYQRQYRNSVQCYQLENL 3113
            .:..|||:.|.||.|.:      :.:....|:.::...:.|      ..||:...||        
Human  3000 VSPEEITSLWSELFNSMFMSFWSSTVTTNPEYWLMWNPLPG------MQQREAPKSV-------- 3050

  Fly  3114 STRLD-CVQGPSEEGSTDISSQFCYR--------GP-ALSGV-ILSLICQPNGQLRSVPLSELLE 3167
               || .::||... :..|.|:.|:.        .| .:||: |||        ...|.|.|.:|
Human  3051 ---LDSTLKGPGNL-NRPIFSKCCFEVLTSSWRASPWDVSGLPILS--------SSHVTLGEWVE 3103

  Fly  3168 WRSALQQTRHLIWENSQLLTSRYSGEVNNLLQAKENARQL--LKEL-------EYVRKLSEKEQK 3223
            ....||....::|.|..:.:.......::.||.:...|.|  |.||       ||::...:....
Human  3104 RTQQLQDISSMLWTNMAISSVAEFRRTDSQLQGQVLFRHLAGLAELLPESRRQEYMQNCEQLLLG 3168

  Fly  3224 ANQGFENCAKELEKMI--EKLEK---------------EENNNASMTKDFEVSLTNALVGAIELC 3271
            ::|.|::..:.|..|.  |.|.|               |..:..|:.:..:.......:|.:::.
Human  3169 SSQAFQHVGQTLGDMAGQEVLPKELLCQLLTSLHHFVGEGESKRSLPEPAQRGSLWVSLGLLQIQ 3233

  Fly  3272 LLTNTPLIDPVEKNRLKNEYIAEDIDCL----------STLTTAYDFM-KIAMKYRHFGEEIYSE 3325
            ........||..|...|..|:.|::..|          |.|.|..|.. ::.:.|.|      ..
Human  3234 TWLPQARFDPAVKREYKLNYVKEELHQLQCEWKTRNLSSQLQTGRDLEDEVVVSYSH------PH 3292

  Fly  3326 LELRLRTALQRQQQLS----QKLALRSEKCLYASLVQDITHFLHSNGDCESLYKLFQLIHSEWEN 3386
            :.| ||..:.|...|:    :|.|.|.:...|.||||:|.|::.|.....::..|...:      
Human  3293 VRL-LRQRMDRLDNLTCHLLKKQAFRPQLPAYESLVQEIHHYVTSIAKAPAVQDLLTRL------ 3350

  Fly  3387 FQGLHV--ATSAQLKSSIEVLGKLDLWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLE 3449
            .|.||:  ..|||:..|:  |.:...|..:..:| ...||....:|.|.|.|::.|:.||:.|  
Human  3351 LQALHIDGPRSAQVAQSL--LKEEASWQQSHHQF-RKRLSEEYTFYPDAVSPLQASILQLQHG-- 3410

  Fly  3450 SLKVIFTRVQQA--GSVSQAEQMQQTIGDIVQFPSQHPLV------------IRNSRLYGLLAEL 3500
             ::::.:.:..:  .|:..|:::......::.|||..|..            :::..:...|.:|
Human  3411 -MRLVASELHTSLHSSMVGADRLGTLATALLAFPSVGPTFPTYYAHADTLCSVKSEEVLRGLGKL 3474

  Fly  3501 ------------------PHSEYEYFRLLKAKLSELSNYIALGRVIDETTFAAYDDALSICNQTW 3547
                              |..|    :||...|..|.:::.....:|:.....:..........|
Human  3475 ILKRSGGKELEGKGQKACPTRE----QLLMNALLYLRSHVLCKGELDQRALQLFRHVCQEIISEW 3535

  Fly  3548 QQEEHRRCQLKAEAES-LYVTKTKGG--VDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVL 3609
            .::| |..|.|||.|| ||..:::..  ..|||..|.:|....||.: ::|||:.:.|||||   
Human  3536 DEQE-RIAQEKAEQESGLYRYRSRNSRTALSEEEEEEREFRKQFPLH-EKDFADILVQPTLE--- 3595

  Fly  3610 KLDKKASAKDKQSQIVVEEDYAFLARNFID-VMTRHTQ--------VYYKE--QPKSSKELELHL 3663
              :.|.::..::.:  ...:.|.|::|.:. ||..|.|        ::|::  .|..:|    |.
Human  3596 --ENKGTSDGQEEE--AGTNPALLSQNSMQAVMLIHQQLCLNFARSLWYQQTLPPHEAK----HY 3652

  Fly  3664 LAPYQARFQVFANLHGHYKTALGSSLEER-------AC---NGLAFGLALQQKQLRDIELEEGVS 3718
            |:.:.:.:|..|:|..|:...:|..|.:|       ||   :...||.|.....::        .
Human  3653 LSLFLSCYQTGASLVTHFYPLMGVELNDRLLGSQLLACTLSHNTLFGEAPSDLMVK--------P 3709

  Fly  3719 SSPYDFYKDSNISEIQSCLDVMERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFN 3783
            ..|||||:..|:.|.:.|..|::...:.|...|:.:|||..|..:.:|:.|||..|..:|:.:|.
Human  3710 DGPYDFYQHPNVPEARQCQPVLQGFSEAVSHLLQDWPEHPALEQLLVVMDRIRSFPLSSPISKFL 3774

  Fly  3784 TGFQLLRQKLALWNEVAHRNNNLVSEEIEVAEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWF 3848
            .|.::|..|...|.|.|.|..:|......:::.:.||.:|||..|...|..|..:...::.::||
Human  3775 NGLEILLAKAQDWEENASRALSLRKHLDLISQMIIRWRKLELNCWSMSLDNTMKRHTEKSTKHWF 3839

  Fly  3849 FIYNLLQQFIHQKQLDHSYTDIKLAEQRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYG 3913
            .||.:|::.: |:|.:....|                      :::.|..:|..|:.|:|.|..|
Human  3840 SIYQMLEKHM-QEQTEEQEDD----------------------KQMTLMLLVSTLQAFIEGSSLG 3881

  Fly  3914 DFHIRLQLLQGFELYLHNVERAGKINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLK 3978
            :||:|||:|..|..:   |....::.|...|.:.|.||..|:.||...:.......|||:||:||
Human  3882 EFHVRLQMLLVFHCH---VLLMPQVEGKDSLCSVLWNLYHYYKQFFDRVQAKIVELRSPLEKELK 3943

  Fly  3979 EFVKIQSYSKDLSYFSMRNSVASVHRNLNKFLKEY--------RLSIQEKISE-----VFQPKDS 4030
            |||||..:: |:|::|::.||...||.|.||:|::        |.|:.|...|     :.:|.|.
Human  3944 EFVKISKWN-DVSFWSIKQSVEKTHRTLFKFMKKFEAVLSEPCRSSLVESDKEEQPDFLPRPTDG 4007

  Fly  4031 TAKDYTFGTDKGKGLRNYNKIKYLHTERQQFVASEKLLEKFAIQEEFLS-----------DNTLL 4084
            .|.:.:       .::|.|:           ...|.||.:.|..:..:.           :..||
Human  4008 AASELS-------SIQNLNR-----------ALRETLLAQPAAGQATIPEWCQGAAPSGLEGELL 4054

  Fly  4085 QRLDKHFRTARHVVKETLGQVPYGELITELDDLLASQLERCEHLRSLNVDRSKERPQQKQEAKQI 4149
            :||.|..:..|.:....:.:.|...|:..||......:.....|:||.|:.|.|:.:|:.|||.|
Human  4055 RRLPKLRKRMRKMCLTFMKESPLPRLVEGLDQFTGEVISSVSELQSLKVEPSAEKEKQRSEAKHI 4119

  Fly  4150 LQQKRKALTDLFKMLHRLGANYKTGLLELSLRNEFEDFQLPPYSIRSMLPRLHPTAQQLDEHL-- 4212
            |.||::||:||||.|.::|.:|:.||.....:|..|...|.|..::|.|..:..| |:.|..|  
Human  4120 LMQKQRALSDLFKHLAKIGLSYRKGLAWARSKNPQEMLHLHPLDLQSALSIVSST-QEADSRLLT 4183

  Fly  4213 ---------DLYYMKSVFKLKLLQNIMLTPLSELGPPNIERIKGFAVDLFLLVQQQREHLSGSTK 4268
                     ..|:.:|:.:...|...:.||..|:|..|:||.:||:..|..::.:||..|:..::
Human  4184 EISSSWDGCQKYFYRSLARHARLNAALATPAKEMGMGNVERCRGFSAHLMKMLVRQRRSLTTLSE 4248

  Fly  4269 ELHELRNSLDSLRKLAEII-----------PQADINPSTLNFVKSADIAMEIKQHL-RQIHYVLK 4321
            :...|||.|..::::...:           ||..:...|           |..||| .|...:|:
Human  4249 QWIILRNLLSCVQEIHSRLMGPQAYPVAFPPQDGVQQWT-----------ERLQHLAMQCQILLE 4302

  Fly  4322 QWKLLLSCAPSSFIEESENRLLV---------RKISLAQSELHSLCIQILNSS------------ 4365
            |...||.|.||.........:.|         ....|::.:|..:.:.::.|:            
Human  4303 QLSWLLQCCPSVGPAPGHGNVQVLGQPPGPCLEGPELSKGQLCGVVLDLIPSNLSYPSPIPGSQL 4367

  Fly  4366 --------------------QELLNELN--NANLEYLSSEKCVTYQKSYAEIQENIKKTLELLR- 4407
                                .|:|..:.  .|:::.:..:.|.|...|:.:. |.....|..|. 
Human  4368 PSGCRMRKQDHLWQQSTTRLTEMLKTIKTVKADVDKIRQQSCETLFHSWKDF-EVCSSALSCLSQ 4431

  Fly  4408 -----TGQNDYLPLAQPIVELLDS-VQLKNHTEIAPEAIDLANAD-------------------- 4446
                 .|......|....||..|| :.|....|.....|..|.||                    
Human  4432 VSVHLQGLESLFILPGMEVEQRDSQMALVESLEYVRGEISKAMADFTTWKTHLLTSDSQGGNQML 4496

  Fly  4447 --------TELANIA-HSVLMSMQKIYKHHVKTDEVNQNGEAKEQDEESKEALQEQHLKKCLTGE 4502
                    :|...|| .::|.::|.:.:...:..|.|.:..:.::|....|.||..||.|.|..:
Human  4497 DEGFVEDFSEQMEIAIRAILCAIQNLEERKNEKAEENTDQASPQEDYAGFERLQSGHLTKLLEDD 4561

  Fly  4503 LTSDWQQLSLPRVLGKLSNVL----------LVLKHSHFEGKDKLLCVRRAIGLLPVLEQYQLLA 4557
            ..:|...|.:.:::..:|.:|          ...||..|.....||     :.|:|||..|..|.
Human  4562 FWADVSTLHVQKIISAISELLERLKSYGEDGTAAKHLFFSQSCSLL-----VRLVPVLSSYSDLV 4621

  Fly  4558 DYLLLQQLATHKVSAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKNGEGFGLEDGTGE 4622
            .:.|...||||:.:||:||::..||.|:..||||:|.:.|:|..|:...|..:.||.|:.:|.|.
Human  4622 LFFLTMSLATHRSTAKLLSVLAQVFTELAQKGFCLPKEFMEDSAGEGATEFHDYEGGGIGEGEGM 4686

  Fly  4623 NDASDKIESEDQLDDAKRPEDRKDEGDKQEPDCK-----EEKGIEMSDDFDAKMQD--VEKPEED 4680
            .|.||:|.:|:|::|..:   :..|.||::||.|     |:..||||:|||.||.|  :|:.|||
Human  4687 KDVSDQIGNEEQVEDTFQ---KGQEKDKEDPDSKSDIKGEDNAIEMSEDFDGKMHDGELEEQEED 4748

  Fly  4681 DSGESEEEEDLNKEMGETE-EGAEKLDDQIWGDDEEEKPEEEQE-------PDMNEEDQGKGSKD 4737
            |.....|..||:|.||:.. |.|:|||:::||||:||:.|||::       |.|:|||....:||
Human  4749 DEKSDSEGGDLDKHMGDLNGEEADKLDERLWGDDDEEEDEEEEDNKTEETGPGMDEEDSELVAKD 4813

  Fly  4738 EKDAHNDLDTKN---DAAKEDGKDEHEKDGLDATNEPSGEDKRKEQAKDIDDMKDPEMDEEQTNA 4799
            :     :||:.|   |.:::|.|:  ||:..:|.:...||||..||   ||:.   :.||.:.:.
Human  4814 D-----NLDSGNSNKDKSQQDKKE--EKEEAEADDGGQGEDKINEQ---IDER---DYDENEVDP 4865

  Fly  4800 MHNELEEPPEPEEMDLGDMNNVDE-----GHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDD 4859
            .|...|:.||||.:||.|..|:|.     |.|..:|:..:|||.:|         .|:||..|  
Human  4866 YHGNQEKVPEPEALDLPDDLNLDSEDKNGGEDTDNEEGEEENPLEI---------KEKPEEAG-- 4919

  Fly  4860 EHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDDSKPE 4924
             |:|.|.|:.::|.::|:..:...|. |:|:|..||||        |.:|.     .|:.|....
Human  4920 -HEAEERGETETDQNESQSPQEPEEG-PSEDDKAEGEE--------EMDTG-----ADDQDGDAA 4969

  Fly  4925 DSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQDPDIKQDQKLDE 4989
            ..||:..||:::..||        |||.:.||..::.|       |||..|||:.:.::|...:|
Human  4970 QHPEEHSEEQQQSVEE--------KDKEADEEGGENGP-------ADQGFQPQEEEEREDSDTEE 5019

  Fly  4990 Q------------------------------------ETGEEKDGVGQAE-NDADDGGHQGVAET 5017
            |                                    |.|:|:.|.|.|: |.|:  ||:.....
Human  5020 QVPEALERKEHASCGQTGVENMQNTQAMELAGAAPEKEQGKEEHGSGAADANQAE--GHESNFIA 5082

  Fly  5018 QETVSQEDRKNERQTQE-KRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKP--E 5079
            |....:..|||   ||. |||.|:.:.|||:|:..:...|:|:|:|       :|...::.|  :
Human  5083 QLASQKHTRKN---TQSFKRKPGQADNERSMGDHNERVHKRLRTVD-------TDSHAEQGPAQQ 5137

  Fly  5080 PMDQTE-AEEYQHVKEPKNS-DKTTLDNATEEQSKKIQHQEDEPPNEEEIEAENVDELMEAEE-- 5140
            |..|.| |:.::|:|:..:: |..|.|.|::||.   |..:|...::||.|.|  |.||:.||  
Human  5138 PQAQVEDADAFEHIKQGSDAYDAQTYDVASKEQQ---QSAKDSGKDQEEEEIE--DTLMDTEEQE 5197

  Fly  5141 --PAVDPE-----------------DDAELEQLGAEKTEQKSDKPSKTEKSKEQLET--PEGMEI 5184
              .|.|.|                 |:.|:| :...|||:  |:..:|:|:.::.|.  ||    
Human  5198 EFKAADVEQLKPEEIKSGTTAPLGFDEMEVE-IQTVKTEE--DQDPRTDKAHKETENEKPE---- 5255

  Fly  5185 EGEVVLTMTVPRSSETTAHSNSEILLDK--SSHAEDLSSAEQIELRQQYQKQLTTFRVAQ---PE 5244
                       ||.|:|.|:..:.|:|.  ....:|::     ||||:.::||..::..:   ||
Human  5256 -----------RSRESTIHTAHQFLMDTIFQPFLKDVN-----ELRQELERQLEMWQPRESGNPE 5304

  Fly  5245 HEDY--ETWQGISNRMTQNARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKD 5307
            .|..  |.||.........::.|||:||||||||:..:||||||||:|:|::|:|||||||||||
Human  5305 EEKVAAEMWQSYLILTAPLSQRLCEELRLILEPTQAAKLKGDYRTGKRLNIRKVIPYIASQFRKD 5369

  Fly  5308 KIWLRRTKPAQRDYKITIAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQI 5372
            |||||||||::|.|:|.:|||||.||..|::|.|..|:::::..||||||.|::::.||||:.::
Human  5370 KIWLRRTKPSKRQYQICLAIDDSSSMVDNHTKQLAFESLAVIGNALTLLEVGQIAVCSFGESVKL 5434

  Fly  5373 ILNHTEQF---DGPRLVNALNFAQDKTKIAGLL----NFIRTANAEESGTGGDNGLFENLLLILS 5430
            :....|||   .|.:::....|.|.|||||..|    |....|.........:..   .|||::|
Human  5435 LHPFHEQFSDYSGSQILRLCKFQQKKTKIAQFLESVANMFAAAQQLSQNISSETA---QLLLVVS 5496

  Fly  5431 DGRNIFSEGAQNVKNAIKLARLQRIFLVYIIIDNPDNKNSILDIQHVAVNADGSV-NINSYLDSF 5494
            |||.:|.||.:.|..|::.||...||::::::|||.:::|||||:.......|.: .|.||::.|
Human  5497 DGRGLFLEGKERVLAAVQAARNANIFVIFVVLDNPSSRDSILDIKVPIFKGPGEMPEIRSYMEEF 5561

  Fly  5495 PFPYYVIVRDLNQLPLVLSEAMRQWFELVNS 5525
            |||||:|:||:|.||..||:|:|||||||.:
Human  5562 PFPYYIILRDVNALPETLSDALRQWFELVTA 5592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1853/5797 (32%)
P-loop_NTPase 315..505 CDD:304359 77/192 (40%)
P-loop_NTPase <887..972 CDD:304359 55/86 (64%)
P-loop_NTPase 1147..1283 CDD:304359 101/136 (74%)
P-loop_NTPase 1454..1603 CDD:304359 91/156 (58%)
P-loop_NTPase 1795..1946 CDD:304359 93/152 (61%)
P-loop_NTPase <2335..>2378 CDD:304359 24/46 (52%)
Prothymosin 4843..4920 CDD:281265 21/77 (27%)
PHA03151 4856..5060 CDD:177546 66/242 (27%)
MttA_Hcf106 <5046..5166 CDD:294511 41/145 (28%)
vWA_midasin 5261..5526 CDD:238737 131/274 (48%)
MDN1NP_055426.1 AAA-ATPase protomer 1. {ECO:0000255} 307..591 122/350 (35%)
P-loop_NTPase 325..453 CDD:304359 76/182 (42%)
AAA-ATPase protomer 2. {ECO:0000255} 659..978 157/320 (49%)
AAA 659..>780 CDD:99707 59/122 (48%)
P-loop_NTPase 672..902 CDD:304359 114/231 (49%)
AAA-ATPase protomer 3. {ECO:0000255} 1048..1316 169/271 (62%)
AAA 1079..1221 CDD:214640 106/142 (75%)
P-loop_NTPase 1079..1215 CDD:304359 101/136 (74%)
AAA-ATPase protomer 4. {ECO:0000255} 1362..1616 129/261 (49%)
AAA 1383..1540 CDD:214640 92/158 (58%)
AAA_5 1385..1540 CDD:285029 91/156 (58%)
MoxR 1736..>1923 CDD:223786 108/233 (46%)
AAA-ATPase protomer 5. {ECO:0000255} 1738..1995 139/319 (44%)
P-loop_NTPase 1748..1888 CDD:304359 93/152 (61%)
AAA-ATPase protomer 6. {ECO:0000255} 2053..2313 83/294 (28%)
P-loop_NTPase <2220..2306 CDD:304359 43/87 (49%)
Linker. {ECO:0000250|UniProtKB:Q12019} 2418..4691 554/2473 (22%)
Prothymosin 4912..5020 CDD:281265 42/140 (30%)
vWA_midasin 5323..5593 CDD:238737 131/274 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354813586
eggNOG 1 0.900 E1_COG5271
Hieranoid 1 1.000
Homologene 1 1.000 H39689
Inparanoid 1 1.050 2416 1.000 Inparanoid score I33
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D138219at2759
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 1 1.000 T1072296
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.