DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and VWA8

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_055873.1 Gene:VWA8 HGNCID:29071 Length:1905 Species:Homo sapiens

Alignment Length:2306 Identity:445/2307 (19%)
Similarity:745/2307 (32%) Gaps:865/2307 (37%)


  Fly   375 SKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLTQAVMH 439
            :||::|.:.|..     :||            :||.|.     |.....|...::.....:|...
Human   127 TKREVEYIALSR-----DTT------------ETDLKQ-----RREIRAGTAFYIDQCAVRAATE 169

  Fly   440 GYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASNSSQKSLY 504
            |..|:||.|:.|.::...:|::|||.:         .:::|.|..|....|.:|...:.::|.|.
Human   170 GRTLILEGLEKAERNVLPVLNNLLENR---------EMQLEDGRFLMSAERYDKLLRDHTKKELD 225

  Fly   505 SLLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSSGNHTSADNLRQQESGDKA 569
            |.        .|:.:|.|  .:::::..|             :...|||........:.::.|  
Human   226 SW--------KIVRVSEN--FRVIALGLP-------------VPRYSGNPLDPPLRSRFQARD-- 265

  Fly   570 DNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSECAYFVFQ--NAVDVFCS 632
                 ...|||                 :|.:||.      :|:.::..|..|.|  :.....| 
Human   266 -----IYYLPF-----------------KDQLKLL------YSIGANVSAEKVSQLLSFATTLC- 301

  Fly   633 YLPQSKEKVTL------ITSIGAKLGIIRS----RCEHFANEYKP-DVEFGLEHIKIGRASLLAK 686
                |:|..||      :.|:.|.:.|:.|    ..:|......| .:..|.|. |:....:|.:
Human   302 ----SQESSTLGLPDFPLDSLAAAVQILDSFPMMPIKHAIQWLYPYSILLGHEG-KMAVEGVLKR 361

  Fly   687 SDLNNSENEDISEQDLKRQKLSQ----QTRRAIGKVSNKRTTFSF---TRLAS--CILERIAVCV 742
            .:|.:|.:..:.::.:|.:|:.:    |....| ::::|..|...   |||.|  |..:|....:
Human   362 FELQDSGSSLLPKEIVKVEKMMENHVSQASVTI-RIADKEVTIKVPAGTRLLSQPCASDRFIQTL 425

  Fly   743 THSE------------PVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVE 795
            :|.:            .:.|:|..|.|||                |...|.:|.           
Human   426 SHKQLQAEMMQSHMVKDICLIGGKGCGKT----------------VIAKNFADT----------- 463

  Fly   796 LNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPELKANK 860
            |.|                     |::.:.|:                          .::.|..
Human   464 LGY---------------------NIEPIMLY--------------------------QDMTARD 481

  Fly   861 LLPRWQTLREKLQKLQMQLDKSINISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLSTILE 925
            ||.:..||.              |...|:....|||....|..||||.|:..:|.||..|..::.
Human   482 LLQQRYTLP--------------NGDTAWRSSPLVNAALEGKLVLLDGIHRVNAGTLAVLQRLIH 532

  Fly   926 P------EGSVVL------------------LERGDFTPVKRHPDFRIFACMNP-------NTDI 959
            .      :||.:|                  |::....|:  ||.|||.|...|       :..:
Human   533 DRELSLYDGSRLLREDRYMRLKEELQLSDEQLQKRSIFPI--HPSFRIIALAEPPVIGSTAHQWL 595

  Fly   960 GKKDLPVGIRNRFTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQ-----LYKSLRKLSE 1019
            |.:.|.:     |...::..|....::.::           ::.|.|:.|     |.....||.|
Human   596 GPEFLTM-----FFFHYMKPLVKSEEIQVI-----------KEKVPNVPQEALDKLLSFTHKLRE 644

  Fly  1020 LQLNDGLGNRPVYSLRTLCRSLRICARNLCGSIERNLYESFCLSFLTQL-DPNSHHVVLLLIQNA 1083
            .|  |........||.|. :.|||..|                  |:|. :.|.|..|       
Human   645 TQ--DPTAQSLAASLSTR-QLLRISRR------------------LSQYPNENLHSAV------- 681

  Fly  1084 LLSNVKAILSKQLPQLGENYLD--FEGYWIQ---PGNLEPQ----PC------------------ 1121
                .||.||:.||.|..:.|:  .....|:   ..||||:    .|                  
Human   682 ----TKACLSRFLPSLARSALEKNLADATIEINTDDNLEPELKDYKCEVTSGTLRIGAVSAPIYN 742

  Fly  1122 ----------------THYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSG 1170
                            .|.|:.|.:   |||..    :|: .:||.|....||..::|       
Human   743 AHEKMKVPDVLFYDNIQHVIVMEDM---LKDFL----LGE-HLLLVGNQGVGKNKIVD------- 792

  Fly  1171 NRCLRINNHEHTDLQEYIGTYAADL-------DGKLTFREGVLVQAMRHGFWIILDELNLASTDI 1228
             |.|.:.|.....:|.:..|....|       ||.:.:.:..||:|::.|..:::||.:.|.|::
Human   793 -RFLHLLNRPREYIQLHRDTTVQTLTLQPSVKDGLIVYEDSPLVKAVKLGHILVVDEADKAPTNV 856

  Fly  1229 LEALNRVLDDNRELYIAE-------------TQTLVKAHPNFMLFATQNPPG-------LYGGRK 1273
             ..:.:.|.:|.|:.:|:             .:.:|..||:|.:....|.||       .:|   
Human   857 -TCILKTLVENGEMILADGRRIVANSANVNGRENVVVIHPDFRMIVLANRPGFPFLGNDFFG--- 917

  Fly  1274 TLSRAFKNRFIELHFADIPR--EELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTSKQVFTLR 1336
            ||...|     ..|..|.|:  .|||.:.:....:|....:|:|....:|               
Human   918 TLGDIF-----SCHAVDNPKPHSELEMLRQYGPNVPEPILQKLVAAFGEL--------------- 962

  Fly  1337 DLFRWGNRYTHADKSLHDDN--RYDWN--------QHLVE---EGYLVLSSKVRSQEEHELIEKT 1388
                         :||.|..  .|.::        :||.:   ||   |||.||:     :.:..
Human   963 -------------RSLADQGIINYPYSTREVVNIVKHLQKFPTEG---LSSVVRN-----VFDFD 1006

  Fly  1389 LFANFRKKLDLQTL--FDIQTDRESSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEF 1451
            .:.|..:::.:.||  :.|....:.:|                             |..||.|..
Human  1007 SYNNDMREILINTLHKYGIPIGAKPTS-----------------------------VQLAKELTL 1042

  Fly  1452 DEPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPCRGKESTQLFEWADGP 1516
            .|...:      |..|:.|     |...::.|.|.:.|...|.                   .||
Human  1043 PEQTFM------GYWTIGQ-----ARSGMQKLLCPVETHHIDI-------------------KGP 1077

  Fly  1517 LIYAMQEGSYFMADEISL--AEDSV-----LERLNCIL------EPERTVLLAEKGGISELDASP 1568
            .:..:||......:|.||  .|:..     |:.:|.|.      |.|:..|..    ::...||.
Human  1078 ALINIQEYPIERHEERSLNFTEECASWRIPLDEINIICDIATSHENEQNTLYV----VTCNPASL 1138

  Fly  1569 DFV-VQAKSGFQFLATMNPGGDFGKKELSPALRN----RFTEVWCLPSDNKEDLIEIAYNCMRRQ 1628
            .|: :..|||| |:       ||  .::.|...|    .|..|..|.|..|..::          
Human  1139 YFMNMTGKSGF-FV-------DF--FDIFPRTANGVWHPFVTVAPLGSPLKGQVV---------- 1183

  Fly  1629 KEHENQAINTHKVAEYLVDVVLHIRDTNDKF---------KFSVRDILAWANYMVSNAKL----S 1680
             .||.|:           :|:| :.||..:.         ||:.:....|........|:    |
Human  1184 -LHEQQS-----------NVIL-LLDTTGRALHRLILPSEKFTSKKPFWWNKEEAETYKMCKEFS 1235

  Fly  1681 FAEQAIF----GLETIFLDALEMLPHESQEQVELLKSNIVKQAIKQASLILQEKFTLEELS---- 1737
            .....:|    |.....||.||...|.....:.|          |...|:.::|:.|.|..    
Human  1236 HKNWLVFYKEKGNSLTVLDVLEGRTHTISLPINL----------KTVFLVAEDKWLLVESKTNQK 1290

  Fly  1738 ---------EKRGTEV--------ELNECRFGIR-------PFFIDVNQ---ERLTSAKEDFLFD 1775
                     |..|:.|        |.....||:.       |..|..:|   |.|:||.|..: .
Human  1291 YLLTKPAHIESEGSGVCQLYVLKEEPPSTGFGVTQETEFSIPHKISSDQLSSEHLSSAVEQKI-A 1354

  Fly  1776 APTTKQNLFRLLS--------------------ALSLQKPVLLEGPPGV------GK-------- 1806
            :|.      |:||                    ..|.::|..|....|.      ||        
Human  1355 SPN------RILSDEKNYATIVVGFPDLMSPSEVYSWKRPSSLHKRSGTDTSFYRGKKKRGTPKQ 1413

  Fly  1807 TSIVESIGSAIGYQIVRINLCEHTDLADLFGTDL--PAEDNLLESNTAATERQIRSFVWRDGPLL 1869
            ::.|..:.:   .|:|||.......|.|::..|:  |.....:|    .|:.|.:...:...|..
Human  1414 SNCVTLLDT---NQVVRILPPGEVPLKDIYPKDVTPPQTSGYIE----VTDLQSKKLRYIPIPRS 1471

  Fly  1870 AALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKSFHLAGSTRIFACQNPLKQGGG 1934
            .:|....||       |:..|..:.|.|..|..|.|.:       .:.|..|::..        |
Human  1472 ESLSPYTTW-------LSTISDTDALLAEWDKSGVVTV-------DMGGHIRLWET--------G 1514

  Fly  1935 RKGLPQSFL---------NRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLNAYFLELLDQKAEGNL 1990
            .:.|.:|.:         :|..::.:.:.|.||   |.:.|:||. |..|.       ....||.
Human  1515 LERLQRSLMEWRNMIGQDDRNMQITINRDSGED---VSSPKHGKE-DPDNM-------PHVGGNT 1568

  Fly  1991 FEIYSGKESSCKSDSFDLGARLVRFSEQLDRGVASMEFGYKGGPYEFNLRDILRWCDLLHNPQTG 2055
            :...:|                       .|..|.:  |.|||||..         |..|   |.
Human  1569 WAGGTG-----------------------GRDTAGL--GGKGGPYRL---------DAGH---TV 1596

  Fly  2056 YILG-----ASPS------------SFQAAFKDFLLT-----LYERM-----QLVYYQRMRCD-- 2091
            |.:.     |.|.            :||...|:..::     .|||.     :.|:..|:..|  
Human  1597 YQVSQAEKDAVPEEVKRAAREMGQRAFQQRLKEIQMSEYDAATYERFSGAVRRQVHSLRIILDNL 1661

  Fly  2092 ----QDKSYIRNVFSTVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQADVLDLVNRQEQS 2152
                :::.::|:. :|..|.||:.::.::.:.|:|                       ..|.|..
Human  1662 QAKGKERQWLRHQ-ATGELDDAKIIDGLTGEKAIY-----------------------KRRGELE 1702

  Fly  2153 PLLLDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLSNRLCN------TDIIDDSVT 2211
            | .|.|.:|:.|::...|.:...:......|....:.::|:|::.....|      .||:..|..
Human  1703 P-QLGSPQQKPKRLRLVVDVSGSMYRFNRMDGRLERTMEAVCMVMEAFENYEEKFQYDIVGHSGD 1766

  Fly  2212 G-SFQQIDLNRHLEIIYKKVETLVFSCVQRAFVLHTQSEFVEQLWNNWSMYNKLAKVTTEAQQHS 2275
            | :...:.:|:..:...:::|.|.        .:|..|:|...           ...|.|..:|:
Human  1767 GYNIGLVPMNKIPKDNKQRLEILK--------TMHAHSQFCMS-----------GDHTLEGTEHA 1812

  Fly  2276 VLDELK----------LFSERLGSLG----KIIEVLEATPQNCQVRALQ-QLAEIKSQLLLLQTY 2325
            :.:.:|          |....|...|    |..::|...|   ||.|.. .:..:..|...||. 
Human  1813 IKEIVKEEADEYFVIVLSDANLSRYGIHPAKFAQILTRDP---QVNAFAIFIGSLGDQATRLQR- 1873

  Fly  2326 IKTADSLNTGGSFEWVDS--------QIVTS 2348
                 :|..|.||..:|:        ||.||
Human  1874 -----TLPAGRSFVAMDTKDIPQILQQIFTS 1899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 445/2307 (19%)
P-loop_NTPase 315..505 CDD:304359 29/130 (22%)
P-loop_NTPase <887..972 CDD:304359 28/116 (24%)
P-loop_NTPase 1147..1283 CDD:304359 37/163 (23%)
P-loop_NTPase 1454..1603 CDD:304359 34/167 (20%)
P-loop_NTPase 1795..1946 CDD:304359 34/176 (19%)
P-loop_NTPase <2335..>2378 CDD:304359 8/23 (35%)
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
VWA8NP_055873.1 Interaction with PEX7. {ECO:0000269|PubMed:30204880} 1..261 37/188 (20%)
AAA_5 105..261 CDD:285029 37/188 (20%)
P-loop_NTPase 442..585 CDD:304359 45/233 (19%)
AAA_5 776..923 CDD:285029 36/159 (23%)
vWA_F11C1-5a_type 1713..1902 CDD:238732 41/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.