DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and SMTNL1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001099035.2 Gene:SMTNL1 HGNCID:32394 Length:494 Species:Homo sapiens

Alignment Length:415 Identity:105/416 (25%)
Similarity:161/416 (39%) Gaps:121/416 (29%)


  Fly  4597 MQDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRP-EDRK-------DEGDKQEP 4653
            |:.:||:..           ||||..:.|:|..|    :.....| |:.|       :||...|.
Human     1 MEQKEGKLS-----------EDGTTVSPAADNPE----MSGGGAPAEETKGTAGKAINEGPPTES 50

  Fly  4654 DCKEEKGIEMSDDFDAKMQ------DVEKPE--EDDSGESEEEEDLNKEMGETEE---GAEKLDD 4707
            . |:||. ...|...|::|      |..|.|  .:..|:.:.|.:|.||.||.||   |::::. 
Human    51 G-KQEKA-PAEDGMSAELQGEANGLDEVKVESQREAGGKEDAEAELKKEDGEKEETTVGSQEMT- 112

  Fly  4708 QIWGDDEEEKPE----EEQEPDMNEEDQGKGSKDEKDAHNDLDTKNDAAKEDGKDE-----HEKD 4763
               |..||.|.|    ||:|..:..|.|   ..:||:|..:...|.||...| |.|     .|:|
Human   113 ---GRKEETKSEPKEAEEKESTLASEKQ---KAEEKEAKPESGQKADANDRD-KPEPKATVEEED 170

  Fly  4764 GLDATNEPSGEDKR-----KEQAKDIDDMKDPEMDEEQTNAMHNELE-EPPEPEEMDLGDMNNVD 4822
            ...|:.|.:|:.|.     ||:|.|     :....|.|...:.:|.: ||.||:.          
Human   171 AKTASQEETGQRKECSTEPKEKATD-----EEAKAESQKAVVEDEAKAEPKEPDG---------- 220

  Fly  4823 EGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEEGDPQSDGSDSEEDEAGTEAKP 4887
                                 ||..:...:.|||..:|.:..||.:|   ||.|||.|...|.:|
Human   221 ---------------------KEEAKHGAKEEADAKEEAEDAEEAEP---GSPSEEQEQDVEKEP 261

  Fly  4888 AEEDHGEGEEATPEDEKDEAETQKRGELEDE----------------DDSKPEDSPEDSKEEKE- 4935
               :.|.|...:..:|..|:.|.:...|..:                .:|.|.|.|:...|... 
Human   262 ---EGGAGVIPSSPEEWPESPTGEGHNLSTDGLGPDCVASGQTSPSASESSPSDVPQSPPESPSS 323

  Fly  4936 -EKREEKPEEH--SQSKDKASKEEN 4957
             ||:|:.||..  :.::.:..:.:|
Human   324 GEKKEKAPERRVSAPARPRGPRAQN 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 105/416 (25%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 23/93 (25%)
PHA03151 4856..5060 CDD:177546 30/123 (24%)
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
SMTNL1NP_001099035.2 RR_TM4-6 44..>198 CDD:283990 51/169 (30%)
CH 381..481 CDD:237981
Calmodulin-binding. {ECO:0000250} 476..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.