DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and Vwa8

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_082182.1 Gene:Vwa8 MGIID:1919008 Length:1905 Species:Mus musculus

Alignment Length:2249 Identity:431/2250 (19%)
Similarity:738/2250 (33%) Gaps:750/2250 (33%)


  Fly   375 SKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLTQAVMH 439
            :||::|.:.|..     :||            :||.|.     |.....|...::.....:|...
Mouse   126 TKREVEYIALSR-----DTT------------ETDLKQ-----RREIRAGTAFYIDQCAVRAATE 168

  Fly   440 GYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASNSSQKSLY 504
            |..|:||.|:.|.::...:|::|||.:         .:::|.|..|....|.:|...:.:::.  
Mouse   169 GRTLVLEGLEKAERNVLPVLNNLLENR---------EMQLEDGRFLMSAERYDKLLQDHTKEE-- 222

  Fly   505 SLLDKYLYTINILPLSRNELCKMVSINYPKLS------TVANRIV--DVF---------LTFSSG 552
              ||.:    .|:.:|.|.....:.:..|:.|      .:.:|..  |::         |.:|.|
Mouse   223 --LDAW----KIVRVSENFRVIALGLPVPRYSGNPLDPPLRSRFQARDIYFLPFQDQLKLLYSVG 281

  Fly   553 NHTSADNLRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSE 617
            .:.||:.:.|..|......:::...|.....||.|.|.:.:::.          |.|..|:    
Mouse   282 ANVSAEKISQLLSFATTLCSQESSTLGLPDFPLDSLPEAVQILD----------SFPMMSI---- 332

  Fly   618 CAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRAS 682
                  ::|:.....|        ||:      ||          :|.|..||           .
Mouse   333 ------EHALQWVYPY--------TLL------LG----------HEGKMAVE-----------G 356

  Fly   683 LLAKSDLNNSENEDISEQDLKRQKLSQQ-------TRRAIGKVSNKRTTFSFTRLASCILERIAV 740
            :|.:.:|..|.:..:.::.::.::::..       |.|..||.                      
Mouse   357 VLKRFELQGSGHSLLPKEIVRVERMTDSHGSYAHVTIRVAGKE---------------------- 399

  Fly   741 CVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQSDVSD--LVGG-----------FK 792
             ||...|   .|...|.:..:..:..:...||.::..|.....|.|  |:||           |.
Mouse   400 -VTIKVP---AGTRAVNQPCAPDHFIQTVSHKQLLAEMVQSHMVKDICLIGGKGCGKTVIAKNFA 460

  Fly   793 PVELNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPELK 857
            .: |.|.:.|:      :|.:                                         ::.
Mouse   461 AL-LGYSIEPI------MLYQ-----------------------------------------DMT 477

  Fly   858 ANKLLPRWQTLREKLQKLQMQLDKSINISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLST 922
            |..||.:..||.              |...|:....||:....|..||||.|:..:|.||..|..
Mouse   478 ARDLLQQRYTLP--------------NGDTAWRSSPLVSAAREGKLVLLDGIHRVNAGTLAVLQR 528

  Fly   923 ILEP------EGSVVL------------------LERGDFTPVKRHPDFRIFACMNPNTDIGKKD 963
            ::..      :||.:|                  |:.....|:  ||.|||.|...|..      
Mouse   529 LIHDRELSLYDGSRLLREDRYLSLKEKLQLTDEQLQNRSIFPI--HPSFRIIALAEPPI------ 585

  Fly   964 LPVGIRNR-------FTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQ-----LYKSLRK 1016
              ||...:       .|.||...:.     .|:.|:.:.   :.:::|.|:.|     |.....|
Mouse   586 --VGSTTQQWLGPEFLTMFFFHHMK-----PLVKSEEIQ---VIKETVPNVPQEALEKLLSVTHK 640

  Fly  1017 LSELQLNDGLGNRPVYSLRTLCRSLRICARNLCGSIERNLYESF---CLS-FL-----TQLDPNS 1072
            |.|.|  |........||.|  |.|...:|.|......||:::.   ||| ||     :.|:.| 
Mouse   641 LRETQ--DPTAQSLAASLST--RQLLRISRRLSKYPSENLHDAITKACLSRFLPSLAQSALEKN- 700

  Fly  1073 HHVVLLLIQNALLSNVKAILSKQLPQLGENY--------LDFEGYWIQPGNL-EPQPCTHYILTE 1128
                  |...|:.:|.:..|..:|    |||        |......:...|. |.......:..:
Mouse   701 ------LADAAIETNTEDSLEPEL----ENYKCEVVAGSLKIGAVSVPVHNAHEKMKVPDVLFYD 755

  Fly  1129 SVKKN--LKDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTY 1191
            :|:..  ::|:.:...:|: .:||.|....||..::|        |.|.:.|.....:|.:..|.
Mouse   756 NVQHMVVMEDMLKDFVLGE-HLLLVGNQGVGKNKIVD--------RFLHLLNRPREYIQLHRDTT 811

  Fly  1192 AADL-------DGKLTFREGVLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELYIAE--- 1246
            ...|       .|.:.:.:..||:|::.|..:::||.:.|.|:: ..:.:.|.:|.|:.:|:   
Mouse   812 VQSLTLQPTVKGGLIVYEDSPLVKAVKLGHILVVDEADKAPTNV-TCILKTLVENGEMILADGRR 875

  Fly  1247 ----------TQTLVKAHPNFMLFATQNPPG-------LYGGRKTLSRAFKNRFIELHFADIPR- 1293
                      .:.||..||:|.:.|..|.||       .:|   ||...|     ..|..|.|: 
Mouse   876 IVADAANVDGRENLVAIHPDFRMLALANRPGFPFLGNDFFG---TLGDIF-----SCHAIDNPKP 932

  Fly  1294 -EELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTSKQ-----VFTLRDLFRWGNRYTHADKSL 1352
             .||..:.:....:|....:|:|....:|    :|.:.|     .::.|::.   |...|..|  
Mouse   933 HSELSMLKQYGPDVPEPVLQKLVAAFGEL----RNLADQGIINYPYSTREVV---NIVKHLQK-- 988

  Fly  1353 HDDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFDIQTDRESSSMVSR 1417
                       ...||   |||.||:                       :||.  |..::.|  |
Mouse   989 -----------FPTEG---LSSVVRN-----------------------VFDF--DSYNNDM--R 1012

  Fly  1418 KIL-DAIRNFKLRDDIVWTRNMTRMAVVTAK------ALEFDEP------VLLVGPTGCG-KTTV 1468
            :|| :.:..:.:              .:.||      |.||..|      ..:||.||.| :..:
Mouse  1013 EILMNTLHKYGI--------------PIGAKPTNVQLAKEFPLPEKTFMGYWIVGQTGNGMQKVL 1063

  Fly  1469 CQLLASIADVQLRIL----NCHMHTEGADFLGGLRPCRGKESTQLFEWADGPLIYAMQEGSYFMA 1529
            |....:..|::..:|    ...:....|.||.....|.        .|.             |..
Mouse  1064 CPAETNHVDIKGPVLVNMEKYPIEKHEARFLSFTEECT--------SWK-------------FPL 1107

  Fly  1530 DEISLAEDSVLERLNCILEPERTVLLAEKGGIS----ELDASPDFVV--------QAKSGFQFLA 1582
            ||::|..|..:...|    .|:|:.:|....:|    .:.....|.|        .|...::...
Mouse  1108 DEVNLICDIAVSHEN----GEQTLYVAACNPVSLYFMNMTGKNGFFVDFFDIFPRMASGSWRPFV 1168

  Fly  1583 TMNPGGDFGKKELSPALRNRFTEVWCLPSDNKEDLIEIAYNCMRR----------------QKEH 1631
            |:.|.|       || ||.:.  |......|...|::...:.:||                .|| 
Mouse  1169 TVAPLG-------SP-LRGQV--VLHEEQSNAVLLLDTTGSAIRRLVLPTEEFTSKKSSWWSKE- 1222

  Fly  1632 ENQAINTHKVAEYLVDVVLHIRDTNDKFKFSVRDILAWANYMVSNAKLSFAEQAIFGLETIFL-- 1694
            |.:.....|...:...||.:.:..|   ..:|.|:|....:.:|         ....|.|:||  
Mouse  1223 EGETYRMCKEFSHKNWVVFYKQTGN---SLTVLDVLEGLAHTIS---------LPINLRTVFLVA 1275

  Fly  1695 -DALEMLPHESQEQVELLK-SNIVKQAIKQASLILQEKFTLEELSEKRGTEVELNECRFGI---R 1754
             |...::.:|:.::..|.| ::|..:......|     :.|:|         ||....||:   .
Mouse  1276 EDKWLLVENETNQKYLLTKPAHIGSEDTGACQL-----YMLKE---------ELPSTGFGVTQET 1326

  Fly  1755 PFFI-------DVNQERLTSAKEDFL-------------------FDAPTTKQNLFRLLSALSLQ 1793
            .|.|       .::.|.||||....:                   |....:...::....:.||:
Mouse  1327 EFCIPDKVSSDQLSSENLTSAVGQKIASPNRILSDENSHATIVVGFPDLMSPSEVYSWKRSSSLR 1391

  Fly  1794 KPVLLEGPPGVGK-TSIVESIGSAIGY----QIVRINLCEHTDLADLFGTDL--PAEDNLLESNT 1851
            :|.:.......|| |:......:.:..    |:|||.......|.||:..|:  |.....:|   
Mouse  1392 QPSVTSMTMYTGKRTNATPRHNNCVTLTHTNQVVRILPPGEVPLKDLYPKDVTPPQTAGYIE--- 1453

  Fly  1852 AATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKS--- 1913
             .|:.|.:...:...|...:|.....||          |.:...:|:|        .|.:||   
Mouse  1454 -VTDLQAKKLRYIPVPSAESLSPYTAWI----------SAISDTDALL--------AEWDKSSVV 1499

  Fly  1914 -FHLAGSTRIFACQNPLKQGGGRKGLPQSFL----------NRFTKVYLRKLSTEDLLHVVTEKY 1967
             ..:.|..|::..        |.:.|.||.:          ::..::.:.:.|.||   |...|:
Mouse  1500 TVDMGGRVRLWET--------GLERLQQSLMEWRNMIGQDSDKHVQITIERDSNED---VSDPKH 1553

  Fly  1968 GKYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGVASMEFGYKG 2032
            ||. |..|.       ....||.:...:|                       .|..|.:  |.||
Mouse  1554 GKE-DPDNM-------PHVGGNTWAGGTG-----------------------GRDTAGL--GGKG 1585

  Fly  2033 GPYEFNLRDILRWCDLLHNPQTGY-ILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSY 2096
            |||..:               .|: :...|.....|..:|......|..|..:.||::..|...|
Mouse  1586 GPYRLD---------------AGHPVYQVSEVEKDAVPEDVKRAAREMAQKAFQQRLKEIQMSEY 1635

  Fly  2097 IRNVFSTVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQ--------------ADVLD--- 2144
                       ||....:.|:.|.....|.::.|:::....|:              |.::|   
Mouse  1636 -----------DAATYERFSSAVQRQVHALRIILDNLQAKGKERQWLRHQATGELDDAKIIDGLA 1689

  Fly  2145 ----LVNRQEQSPLLLDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLSNRLCN--- 2202
                :..|:......|.|.:|:.|::...|.:...:......|....:.::|:|::.....|   
Mouse  1690 GEKSIYKRRGDLEPQLGSPQQKPKRLRLVVDVSGSMYRFNGVDRRLERSMEAVCMVMEAFENYEE 1754

  Fly  2203 ---TDIIDDSVTG------SFQQIDLN--RHLEIIYKKVETLVFSCVQRAFVLHTQSEFVEQLWN 2256
               .||...|..|      ...||..|  :.|||:....|...| |:.....|......::.:  
Mouse  1755 KFKYDIAGHSGDGYNIKLVPVNQIPKNNKQRLEILKTMHEHSQF-CMSGDHTLEGTEHAIKDI-- 1816

  Fly  2257 NWSMYNKLAKVTTEAQQHSV--LDELKLFSERLG-SLGKIIEVLEATPQNCQVRALQ-QLAEIKS 2317
                      .|.||.::.|  |.:..|  .|.| :..:..::|.:.|   ||.|.. .:..:..
Mouse  1817 ----------TTEEADEYFVIILSDANL--SRYGINPARFAQILTSDP---QVNAFAIFIGSLGD 1866

  Fly  2318 QLLLLQTYIKTADSLNTGGSFEWVDS--------QIVTS 2348
            |...||.      :|..|.||..:|:        ||.||
Mouse  1867 QAARLQR------TLPAGRSFIAMDTKKIPQILQQIFTS 1899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 431/2250 (19%)
P-loop_NTPase 315..505 CDD:304359 27/130 (21%)
P-loop_NTPase <887..972 CDD:304359 27/116 (23%)
P-loop_NTPase 1147..1283 CDD:304359 38/163 (23%)
P-loop_NTPase 1454..1603 CDD:304359 34/172 (20%)
P-loop_NTPase 1795..1946 CDD:304359 32/172 (19%)
P-loop_NTPase <2335..>2378 CDD:304359 8/23 (35%)
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
Vwa8NP_082182.1 Interaction with PEX7. {ECO:0000250|UniProtKB:A3KMH1} 1..260 35/173 (20%)
AAA_5 104..260 CDD:285029 35/173 (20%)
AAA_5 441..584 CDD:285029 40/207 (19%)
AAA_5 775..922 CDD:285029 37/159 (23%)
vWFA 1713..1902 CDD:294047 45/212 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.