DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and F55F10.1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001263748.1 Gene:F55F10.1 WormBaseID:WBGene00018898 Length:4362 Species:Caenorhabditis elegans

Alignment Length:5527 Identity:1430/5528 (26%)
Similarity:2325/5528 (42%) Gaps:1503/5528 (27%)


  Fly   292 RIVKVDSTVVNLRSIALGVAAAKPI---------------CLSGPVGCGKTTLIEYLARKTGRIC 341
            |||:..|..:..:..||.:...:.:               .:.||:||||:.|..|.|:..|   
 Worm    43 RIVQAGSAELEEKEKALEILPTREVLGNQLVAAIRNHHFAIIEGPLGCGKSFLGRYAAQTLG--- 104

  Fly   342 PKPNEIESREKALKKAEEEEQLLTPKKKAKTTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGD 406
                                                    :||..:               |:||
 Worm   105 ----------------------------------------LPLHIM---------------QMGD 114

  Fly   407 QTDSKMLLGQYRCTDVPGEFVW----------LPGVLTQAVMHGYWLLLEDLDAATQDTYTILSS 461
            |.|||.|.|.|.||:|.|:|||          .|||          :||||:|||..|   ::|.
 Worm   115 QIDSKTLFGSYHCTEVAGQFVWKESAFATWLQAPGV----------VLLEDIDAANAD---VISK 166

  Fly   462 LLE----RQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASNSSQKSLYSLLDKYLYTINILPLSRN 522
            :::    ||..:....:.|       .....:|...:.|...:|:  ::||.....|.:..|:.:
 Worm   167 IVDIASHRQTNASTSDKSS-------HFHEEIRIIATMSGKGKKA--AVLDGVPVRIRVDQLTDD 222

  Fly   523 ELCKMVSINYPKLSTVANRIVDVFLTFSSGNHTSADNLRQQESGDKADNTEQYVALPFEQVPLTS 587
            ||.::.|..:|:::.:|..::..|                               ...|.||.|.
 Worm   223 ELKRLASKAFPRIAHLARTLISTF-------------------------------RKIENVPGTG 256

  Fly   588 SPNSGRLVSTRDLVKLCHRSN--PQFSVTSSECAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAK 650
              ||.::.|| |.::.|.|..  |..|.....     |...:||:|...|:.:.. .|...|.|.
 Worm   257 --NSRQMTST-DFLRGCARLALLPDISANVES-----FAELIDVWCLADPRQRSS-QLCNIIAAS 312

  Fly   651 LGIIRSRCEHFANEYKPDVEFGLEHIKIGRASLLAKSDLNNSENEDISEQDLKRQKLSQQTRRAI 715
            |.:.:.|.....:..:|:|::..:.:.:|||.|                            .|.:
 Worm   313 LNVNQDRVHTHLSVRQPEVKYDEKVVSVGRAHL----------------------------PRKM 349

  Fly   716 GKVSNKRTTFSFTRLASCILERIAVCVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNN 780
            ..:...|.....||....::|||.|||:|:||:||||||||||||.||.:|:.....|.|||::.
 Worm   350 SMIKTGRHRLGHTRDVVQLMERIVVCVSHNEPLLLVGETGVGKTSVVQAVADLIGVTLDVVNVSP 414

  Fly   781 QSDVSDLVGGFKPVELNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMIN 845
            .||..:|:.|:||..:..::.|....:..:..:.|:.:.|.:|:.......:|||....:..:  
 Worm   415 TSDSDELIQGYKPTTIGRLMEPFTKFYMEVFTKNFDSKNNQKFIDNLEKCLSSGRFKDYLSLV-- 477

  Fly   846 ICLQVAKNPELKANKLL-------PRWQTLREKLQKLQMQLDKSINISFAFIPGSLVNCISNGDW 903
                     |..|:|.|       .||..|..:.::::..|:|.. ..||...|:::.....|.|
 Worm   478 ---------EATASKALQRKGQKDERWAELLVRSRQIRDGLEKGA-APFALQKGAVLEAAEKGHW 532

  Fly   904 VLLDEINLASAETLECLSTILEPEGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGI 968
            :|:||||||..|.|:.:...|...|:              ||:||:||||||.||.||:.||.|:
 Worm   533 LLVDEINLAPPECLDAIVHALSAPGT--------------HPNFRLFACMNPATDAGKRRLPPGV 583

  Fly   969 RNRFTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQLYKSLRKLSELQLNDGLGNRPVYS 1033
            |.|||||||.|......|||:||.||..  :.::.|.|:|:.|.|.::|....          ||
 Worm   584 RTRFTEFFVSETADPHQLSLIVSAYLPT--VSQQFVENLVKFYLSAKQLYPSS----------YS 636

  Fly  1034 LRTLCRSLRICARNLCGSIERNLYESFCLSFLTQLDPNSHHVVLLLIQNALLSNVKAILSKQLPQ 1098
            ||||||:|...|.|:.||:::::||:..::|||.|:.....|:.:.||.|....|..:   .:|:
 Worm   637 LRTLCRALLFTADNMFGSVDQSIYEAVSMAFLTNLESEEKKVMTVKIQAAFRFKVGVM---PVPK 698

  Fly  1099 LGENYLDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLID 1163
            ..|||:...||:::.|....:....|::|::||.||.::|||:..|:.||||:|.|||||||::.
 Worm   699 HPENYVKIGGYYVEKGTQLTESDPKYVITKTVKGNLSEIARIVCSGRFPILLEGETSAGKTSIVC 763

  Fly  1164 YVARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFREGVLVQAMRHGFWIILDELNLASTDI 1228
            ::::.:|||.:|||||||||:|||:|:|.||..|:|.||||.||||:|.|.|:||||||||.||:
 Worm   764 HLSKATGNRIVRINNHEHTDVQEYMGSYVADAGGRLVFREGALVQAVRDGSWVILDELNLAPTDV 828

  Fly  1229 LEALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPR 1293
            :|||||:|||||||::.|....:||||.|.|||||||.|.|.|||.||||..:|||.|.|..:|.
 Worm   829 IEALNRLLDDNRELFVPEINETIKAHPRFRLFATQNPAGSYAGRKRLSRALMSRFIVLRFHHLPI 893

  Fly  1294 EELETILEKRCFIPPTYARKMVQCMTQLQQHRK-----NTSKQVFTLRDLFRWGNRYTHADKSLH 1353
            |||..::..||.:||..:.||::.:.:|:..|.     :....:.||||:|||..|.|      .
 Worm   894 EELSEMVCARCGVPPNASLKMIEVLNELRNRRSLSGLFSARDGLMTLRDVFRWAKRMT------T 952

  Fly  1354 DDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLFDIQTDRESSSMVSRK 1418
            |:...||.|.||..||.:|:.:.|::::...:.:||....::|:|.:.||.:.:......:::.|
 Worm   953 DETTDDWLQILVNHGYFLLAGRCRNEKDDVTVVETLEKVIKRKIDKEALFSLDSPYMPRDVITEK 1017

  Fly  1419 ILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLRIL 1483
                         :|.|..|.||.|:|.:|...:|.||:||.||.||||:.::   :...:||.:
 Worm  1018 -------------VVLTLGMRRMLVLTEQAWLRNEAVLMVGETGGGKTTLSEV---VGRGKLRSI 1066

  Fly  1484 NCHMHTEGADFLGGLRPCRGKESTQLFEWADGPLIYAMQEGSYFMADEISLAEDSVLERLNCILE 1548
            |||..||.||.||.|||    :....|||:||.:|.||::|...:.|||||||||||||||.:.|
 Worm  1067 NCHERTETADLLGRLRP----KQDGGFEWSDGVVISAMRDGVPLLVDEISLAEDSVLERLNPLFE 1127

  Fly  1549 PERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELSPALRNRFTEVWCLPSDN 1613
            .:|.:||::.|..:|       ||::|.|||.:||||||||:||||||.||||||||||......
 Worm  1128 EDRALLLSDAGTDTE-------VVESKPGFQMIATMNPGGDYGKKELSKALRNRFTEVWTSSDYT 1185

  Fly  1614 KEDLIEIAYNCMRR-QKEHENQAINTHKVAEYLVD-VVLHIRDTNDKFKF--SVRDILAWANYMV 1674
            ..:|:.|....:.| ....|...|...:.|..:|. :.:.....:..|:.  ||||::|.|....
 Worm  1186 TSELVTIFDQRLARVDATREEARITPTRTATTIVSWIAVFFGKYSHVFRHAPSVRDVVACAELYA 1250

  Fly  1675 S--------NAKLSFAEQAIF-----GLET--------IFLDALEMLPHESQEQVELLKSNIVKQ 1718
            |        ...:..|..|:|     ||.|        :|.|||.|| |.     ||:|:.::.|
 Worm  1251 SAMQAQIENTTAIKDALCAVFLDSLAGLTTRLHIDPVEVFDDALTML-HS-----ELVKTQLLGQ 1309

  Fly  1719 AIKQASLILQEKFTLEELSEKRGTEVELNECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNL 1783
            .......|.:.|  .:.|.|.....:.:...|....|.     ..::..|   |...|||..:|.
 Worm  1310 LSDVQKFIGEAK--KDALIEHASQHLNVGHLRVPFGPV-----TPKIPKA---FSLKAPTCAENF 1364

  Fly  1784 FRLLSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLE 1848
            :|:...|.:.||:||||.||.||:|.|.::....|..|.|:||.:.|||:||||:|:|       
 Worm  1365 YRIARGLLISKPILLEGAPGCGKSSTVMALAQLTGNPITRLNLSDQTDLSDLFGSDVP------- 1422

  Fly  1849 SNTAATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKS 1913
               ..||....:|.|.|||:|.|:| |..||||||:|||.|||||||||..|||..:||.|||:.
 Worm  1423 ---VLTEDGTMTFRWEDGPVLKAIK-KGEWILLDEMNLASQSVLEGLNACFDHRRVLYIAELNRE 1483

  Fly  1914 FHLAGST--RIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDL---LHVVTEKYGKYFDQ 1973
            |.:..::  |.||||||..|||.|:.||:||:||||.:|...|:..|:   |:.|.||.....:|
 Worm  1484 FEIPATSNCRFFACQNPRVQGGNRRALPKSFINRFTNIYTNDLTKNDIEIVLNGVDEKSLLRTEQ 1548

  Fly  1974 LNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGVASMEFGYKGGPYEFN 2038
            .:|                                   :|..||||::    :...:.|||:.||
 Worm  1549 RSA-----------------------------------MVAISEQLEQ----ISGSFSGGPHSFN 1574

  Fly  2039 LRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQDKSYIRNVFST 2103
            |||:|||.|||                 ||.:    ||.|..:|||..|.|.::|:..:|::|. 
 Worm  1575 LRDLLRWYDLL-----------------AAGR----TLGEAFELVYMTRTRREEDRELMRSIFE- 1617

  Fly  2104 VFLCDAEYLNQVSNDVALYWTAD--KVYLNDVVLSRK------QADVLDLVNRQEQSPLLLDSQR 2160
                  :.:.:.....||..|.|  ::.:....|.||      |:....|.||      |..||.
 Worm  1618 ------KMMEEKLVTKALNLTVDEKEMRIGKCSLKRKTQQLGVQSPRKSLENR------LFASQT 1670

  Fly  2161 QQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLSNR-----LCNTDIIDDSVTGSFQQIDLN 2220
            ..:.||...|.:....||.|..:.||..:|:.:..|..:     ..|.|.....:.||::|:...
 Worm  1671 ILMHQIATCVELNWLALLVGPRNCGKRSVIENVANLCGKRLRTIALNADTDAQELIGSYEQVVDE 1735

  Fly  2221 RHLEIIYKKVETLVFSCVQRAFVLHTQS--EFVEQLWNNWSMYNKLAKVTTEAQQHSVLDELKLF 2283
            ..|.|..|::..:         :.|.::  .|:|::.|...: |||     ||....:|.|    
 Worm  1736 DCLPIAKKQIVKI---------LEHKEAPEAFIEKVKNAGDL-NKL-----EATVELILSE---- 1781

  Fly  2284 SERLGSLGKIIEVLEATPQNCQVRALQQLAEIKSQLLLLQTYIKTADSLNTGGSFEWVDSQIVTS 2348
               :|::.:|.:||....|:..                               .|||.||..|.:
 Worm  1782 ---IGNIEEIQDVLNIANQSSM-------------------------------RFEWTDSVFVDA 1812

  Fly  2349 LKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYKSTNFRAFLTVDPKN 2413
            ...|.::|:|.|||||:|||||||...|..|.|::||:    |:|.|.:....:||.||::|.:.
 Worm  1813 YLHGDWLLIEDVNLCSAAVLDRLNSCLESGGKLVVAER----QNSYEPLEPHPDFRVFLSMDARV 1873

  Fly  2414 GELSRAMRNRCVELSLSRDTYSV--DDLRAFVHEQGVREMEAIDCILRVHKGLSQLTEFNNYSIS 2476
            ||:|||||||.||:.: .|.:::  ||:|..|                   |....:|.:.....
 Worm  1874 GEISRAMRNRSVEIYI-EDGWNLWPDDVRTVV-------------------GSKMSSELSRIVAR 1918

  Fly  2477 HLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVYSANTDLMGYGLSYYQNKLREVVLAQTEVFEEV 2541
            .||               :::.:::||:    ...|.:.....|:.   ||             |
 Worm  1919 DLT---------------VEQQLHLAAL----LQENGEHFSMDLAL---KL-------------V 1948

  Fly  2542 AVIQEDFLSDVILNSGNLNSLTLIKRQAVALKVLLDGYTEGKIPQKLLASLFHEMEKLKLDQRNP 2606
            ...|:|:....|..:..:....|:::.|:|.|:|            .:.:|..|.||.       
 Worm  1949 GAAQKDWKDQEIEENEEIEEEILVEKFAIAPKIL------------EICNLSGEYEKF------- 1994

  Fly  2607 QKLIRHFLYMLYESSAIGDLELRHLYLQPWLSKDTAFQELSQNLYNCLQKRSNTDT---GTLANL 2668
                                         |:|   .:|..:.|     .|.:|.:.   ..|::.
 Worm  1995 -----------------------------WIS---TWQRAAAN-----TKTANVEAILMTFLSSS 2022

  Fly  2669 PW-NRKLIPRLRDY---STAESNSELNPLNLSALLLARLVVDIIPVSSVTTVQQMNALQYSQALC 2729
            || .:.|:..|:.:   :..:|..:..|.||.......|:......:|.|.|..    ::|:|:.
 Worm  2023 PWILQNLLENLKGFFGAAAVDSMIKRIPANLLKSNKRHLIDSSFSSASRTDVDS----KFSRAVL 2083

  Fly  2730 KKQVTEKY---------ANHLLANFSSFLEVLHTSLLEDLETADL---DLPQYAHLVTRFHWFNR 2782
            .:.:.:..         |.||.:..:.:          ::.|.|:   :|||.|.||      ..
 Worm  2084 FEWILQMISKIPADHGSAEHLSSTMTKY----------EIATCDVTFNNLPQIATLV------RS 2132

  Fly  2783 ILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHLLVPLI--ELTAKSGCARM-LTIQDRTLKIKK 2844
            |:.|.:.    :..:......::.:...:|   |||...  :||.::|||.: |...|  ||   
 Worm  2133 IIETFKT----SPSISTNAYREVCISISYL---LLVAASRRKLTTRTGCAAIYLAWND--LK--- 2185

  Fly  2845 YIEETRRPLNVTCKIYSKQFTQFQPYYQDQQIQRHIELDDLEKLLSVVPSYGNLELSSWLKRWLL 2909
              .|..:...:.|   ||                           :::.:.|.:. ..|      
 Worm  2186 --NEAAKTSGINC---SK---------------------------TLLTASGKIN-EGW------ 2211

  Fly  2910 LQTDDANKWRSFLRKHTNGFQPKAFEISGSLRNE----TLQSHLQKLQTTLKEAQENSAEIEMDL 2970
                .:..:.:|:.::.:.:  :.|.:.....||    ....|::||   |.|..|.||::||  
 Worm  2212 ----TSESYETFVNEYIHRW--RKFGMCSPFCNEDETRVFLEHIEKL---LGEDTEESADVEM-- 2265

  Fly  2971 ELDLNSIKTLLEAETEESESYIHPDGI-PTNTPKLLIAALRELFMERLLTGTLRDDFDEQVNPLY 3034
             :|::|..   |||.::      |..| |....:.::.::..|| |.|.:|.:     :|.|.::
 Worm  2266 -MDVDSDD---EAEAKK------PLAISPIEVSRNVVDSVEALF-EFLSSGVV-----DQENEVF 2314

  Fly  3035 ADQLLTLNSNLWHCLKTLESANRTEITNAWI--------ELKNEVNELQNYDEFAVL---LEKIG 3088
            .      .||::..:...:|||...|..|.:        :|..|..|.||     :|   |..||
 Worm  2315 K------KSNVFSGVSWKDSANARWIRTAAVLCASVAVCKLSEEEMEEQN-----ILVSDLLSIG 2368

  Fly  3089 GGYKGLRSYQRQYRNSVQCYQLENLSTRLDCVQGPSEEGSTDISSQFCYRGPALSGVILSLICQP 3153
            ||              ..|     |:|||              .....:..|.:|.:.::     
 Worm  2369 GG--------------AHC-----LATRL--------------FFSALHFNPTMSNLSIA----- 2395

  Fly  3154 NGQLRSVPLSEL--LEWRSALQQTRHLIWENSQLLTSRYSGEVNNLLQAKENARQLLKELEYVRK 3216
              .|:..|:.||  ..||.::         ||.|:..                 ||.:.||::  
 Worm  2396 --HLQKFPIKELGTKLWRLSV---------NSSLIRD-----------------QLKQALEHL-- 2430

  Fly  3217 LSEKEQKANQGFENCA------KELEKMIEKLEKEENNNASMTKDFEVSLTNALVGAIELCLLTN 3275
                    ..|.|..|      ..:|:.||.:|.                           .|..
 Worm  2431 --------GVGIEGWAGGAGGSNGMERGIEMMES---------------------------ALPP 2460

  Fly  3276 TPLIDPV--EKNRL------------KNEYIAEDIDCLSTLTTAYDFMKIAMKYRHFGEEIYSEL 3326
            ...:|||  |:.|:            :.:|:||..:.:...:...|               ||..
 Worm  2461 RETLDPVIFEEERMLFVKAKRRIVERQLKYLAEWRNLIGRQSPDCD---------------YSSS 2510

  Fly  3327 ELRLRTALQRQQQLSQKLA-LRSEKCLYASLV--QDITHFLHSNGDCESLYKLFQLIHSEWENFQ 3388
            ::    .:|....|.|:|| |.||:.....:|  |..|.:   |..|..|....:|..|      
 Worm  2511 QV----IIQGLNDLRQELAELESEEGDQQPVVYRQSATQY---NQLCSELRSFLELAKS------ 2562

  Fly  3389 GLHVATSAQLKSSIEV----LGKLDLWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLE 3449
            .:..|.|:|.:|:.::    |.::..:..:|:.|....|.::.::. |...|...       ||.
 Worm  2563 SISDAQSSQEESNEKMMTIRLARIKSFAMSAENFRISILRKFVSFV-DVSMPFIA-------GLL 2619

  Fly  3450 SLKVIFTRV----------QQAGSVSQAEQMQQTIGDIVQFPSQHPLVIRNSRLYGLLAELPHSE 3504
            .:::.|..:          |.|.:.|...:..||:                |...||::      
 Worm  2620 LVEIAFNEIALKWKQEAKRQHATASSAFPRFLQTV----------------SSSSGLIS------ 2662

  Fly  3505 YEYFRLLKAKLSELSNY---------IALGRVIDETTFAAYDDALSICNQTWQQEEHRRCQLK-- 3558
                       :|::|:         :.|...:.....|..|:..||....|.:.:.::...|  
 Worm  2663 -----------NEVTNWAIRDGSPMPLQLKSAVVRRRLAELDEKSSIIEIQWTRAQWKKWYEKNI 2716

  Fly  3559 AEAES---LYVTKT---KGGVDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASA 3617
            |:||.   :|.|||   |..:|.||.....|.:|....:.|           :..:|:     |.
 Worm  2717 AKAEQKDFVYRTKTEEEKDEMDLEEFFANHEQDHQVLPDCD-----------VSMLLE-----SV 2765

  Fly  3618 KDKQSQIVVEEDYAFLARNFIDVMTRHTQVYYKEQPKSSKELELHLLAPYQARFQVFANLHGHYK 3682
            :.|:|.:|.|                      |.:.||.:..|:.::.......:|.|       
 Worm  2766 ERKRSSLVDE----------------------KSRKKSDERYEMAMVWMRYVMSEVGA------- 2801

  Fly  3683 TALGSSLEERACNGLAFGLALQQKQLRDIELEEGVS--------SSPYDFYKDSNISEIQSCLDV 3739
            ..:..:...:..:|       .||....:...||:|        :...|.|::|::.|.:....:
 Worm  2802 IPIDDATWSQCIDG-------DQKLFEVLAAHEGLSDDGGDGEDTKIIDVYRNSSLRECRRVAVI 2859

  Fly  3740 MERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLALWNEVAHRNN 3804
            :|::..|..|.||::||...|..|...|.....:....|.::..|..:.|.:....|..:|.|.|
 Worm  2860 LEKLSIRTKEVLERWPEVVALKTIIETIDEFFTVSVSTPHIKVATQIENLIEVCEQWEMMADRAN 2924

  Fly  3805 NLVSEEIEVAEFVQRWTRLELQHWR----NCLGQTAAQVELQAYRYWFFIYNLLQQFIHQKQLDH 3865
            :|.....|:.:.:..|.::|::.|.    ||..:...:.:|.|:..:                  
 Worm  2925 SLRDPLGELRKLLVDWKKMEVRCWSSLLINCENEAKQRAQLVAFPLF------------------ 2971

  Fly  3866 SYTDIKLAEQRFAQDHLLDAQDLGESQRLEL-AQVVRILRQFVEASCYGDFHIRLQLLQGFELYL 3929
                                :.|.|:...|: |.::.:..:::..:...||..|:       |.:
 Worm  2972 --------------------ESLFEASTPEMEAAIIPMSIEWMHNATLVDFSTRV-------LTV 3009

  Fly  3930 HNVERAGKINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKDLSYFS 3994
            .::.|..:|.|..||...|.....:|..||..:....|..|.|.||.||:::|:..|: ||:.::
 Worm  3010 ESLSRWARIAGKKPLAIQLEAASRHFGIFAERVEQKLKEAREPAEKSLKDYLKVVKYN-DLNLWN 3073

  Fly  3995 MRNSVASVHRNLNKFLKEYRLSIQEKISE---VFQPKDSTAKDYTFGTDKGKGLRNYNKIKYLHT 4056
            :|.|....|..|.|.::.::.:|..::.:   |.|..|..         |.|.|:..| ::.||.
 Worm  3074 IRVSSTKAHAQLYKIVRRFKDAINVELHDDFGVLQKVDEW---------KRKVLQQRN-VRELHL 3128

  Fly  4057 ERQQFVASEKLLEKFA--IQEE--FLSDNTLLQRLDKHFRTARHVVKETLGQVPYGELITELDDL 4117
            :.:......|.:::|:  |.|:  .|.|.:.::.|.:..:.|...::..:..:  ||        
 Worm  3129 DGEDLEKRIKQVKRFSTEITEKVSILCDTSAIEELFEQTKAADEAIRTMINYI--GE-------- 3183

  Fly  4118 LASQLERCEHLRSLNVDRSKERPQ-------QKQEAKQILQQK------RKALTDLFKMLHRLGA 4169
                            |..||:.|       |:|.|..|.:.:      |||:     :|.:...
 Worm  3184 ----------------DSEKEKQQGYARNSRQRQLAMMIKESQAIGLNARKAV-----LLAQEDI 3227

  Fly  4170 NYKTGLLELSLRNEFEDFQLPPYSIRSMLPRLHPTAQQLDEHLDLYYMK---------SVFKLKL 4225
            | :..::.:..:.|.|.......|.|:::.:   .|.::|:.:.:...|         .|:.:.|
 Worm  3228 N-RRSIVGIVSKEECEKEMRICASGRNIVIQ---KANKIDQQVGVSTRKHLSGMIEYGMVYMITL 3288

  Fly  4226 LQNIMLTPLSELG--PPNIERIKGFAVDLFLLVQQQR-------EHLSGSTKELHELRNSLDSL- 4280
            .:||        |  ...:..|:..:.:|.::.:.||       |.:.|..:::..|.:::..| 
 Worm  3289 QENI--------GKWKSQVAEIRVHSEELRIISENQRSDWIIDHEIVKGRVEKIGGLISTVQVLI 3345

  Fly  4281 ----RKLAEIIPQADINPSTLNFVKSADIAMEIKQHLRQIHYV---------LKQWKLLLSCAPS 4332
                |:|..|...||      .|:::       |:||..:..:         |.:|...||....
 Worm  3346 GAIKRRLVAIPANAD------EFIRT-------KEHLHPLSKLSQTDETAQKLTKWAEKLSTLIG 3397

  Fly  4333 SFIEESENRLLVRKISLAQSELHSLCI-QILNSSQELLNELNNANLEYLSSEKCVTYQKSYAEIQ 4396
            :.  :..|..|....|:.....::..| ||...|||||.:|...: .:..:||          ||
 Worm  3398 NM--KRSNDQLSTTFSVVDYNSYTTWISQINGDSQELLTDLQLFS-GFFETEK----------IQ 3449

  Fly  4397 ENIKKTLELLRTGQNDYLPLAQPIVELLDSVQLKNHTEIAP---EAIDLANADTELANIAHSVLM 4458
                                   ||:|||.:         |   :.||...|..|.......:|:
 Worm  3450 -----------------------IVKLLDEI---------PRWAKKIDTFEAAEESETDVTELLL 3482

  Fly  4459 SMQKIYKHHVKTDEVNQNGEAKEQDEESKEALQEQHLKKCLTGELTSDWQQLSLPRVLGKLSNVL 4523
            .:|:|||   |.|.|       ::.||.|...|.|.|...|        :|..:..|:..|.:::
 Worm  3483 LVQRIYK---KLDGV-------KKGEEDKALDQIQVLVDVL--------KQCDIQAVVKSLKSIV 3529

  Fly  4524 LVLKHSHFEGKDKLLCVRRAIGLLPVLEQYQLLADYLLLQQLATHKVSA---------KMLSIVL 4579
                ..|..|:      :|...|..:.|...:.||  :::|......:.         .|||:.:
 Worm  3530 ----EEHCSGE------KRRKNLEGLAELAGITAD--IVEQSVIQLTNCLGFFSVFYHAMLSMTM 3582

  Fly  4580 TVFVEIGSKGFC-VPPDLMQDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRPED 4643
            .::    .||:. ..|...:.|.|:. |...:|||.|:.:|....||.|..|   ::::..:.|.
 Worm  3583 QLY----EKGYVNTIPKAEKQESGEG-QTDDSGEGGGIGEGGTAKDAKDVTE---EMEETGQIEG 3639

  Fly  4644 RKDEG--DKQEPDCK--EEKGIEMSDDFDAKMQDVEKPEEDDSG----ESEEEEDLNKEMGETEE 4700
            .:||.  |.:|.:.|  .||.|:|.|||...:||::|.|:.|..    ||:||.|:..:||:.||
 Worm  3640 LEDEQPVDSEEHEAKNDNEKPIDMEDDFAEDLQDIDKNEKGDQNDGEDESDEEPDVEDQMGDVEE 3704

  Fly  4701 GAEK-LDDQIWGDDEEEKPEEEQEPDMNEEDQGKGSKDEKDAHNDLDTKNDAAKEDGKDEHEKDG 4764
            ..|| ||.::|  |||||.|::|:.:|::|.:                                 
 Worm  3705 EDEKQLDPKMW--DEEEKEEQDQQKNMDQEQE--------------------------------- 3734

  Fly  4765 LDATNEPSGEDKRKEQAKDIDDMKDPEMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDEGHDDQD 4829
                   :.||:..|.....||.:.|:.|.::.....:::||.        .|..||||...:.|
 Worm  3735 -------AAEDQTDEMVAKEDDAQAPKEDPKEDGKEDDQVEED--------DDQENVDERDREND 3784

  Fly  4830 EQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGE 4894
            |:|.|:        .:...|:::.|.....|.|..|:.| ..|.:|.|::||         ..|:
 Worm  3785 ERPEDQ--------MDTSDPSKDDEIPEKGEIDEAEDED-DGDETDKEDEEA---------IEGD 3831

  Fly  4895 GEEATPEDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQ 4959
            |||...||:.|:       ||||     |..:.|::::.:|:|:|::..|.....:|..:::|  
 Worm  3832 GEEDQNEDQNDQ-------ELED-----PTQTNEENEDSEEQKKEDEALEQGTGGEKNDQDDN-- 3882

  Fly  4960 SMPETDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQE 5024
                          :...|..:.::::.::||..:|| |.|::::|.:..|.:|.|      .:|
 Worm  3883 --------------KDVADGGLAEEEEKEDQEDQDEK-GEGKSKSDPNGDGSKGEA------PKE 3926

  Fly  5025 DRKNERQTQEKRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMDQTEAEEY 5089
            ..:.|.:.:||.|......||.         ::|.|          |||..|:.|..|..|.|..
 Worm  3927 KAEKEEEDEEKEKDDEEKVERK---------RELAT----------DDAPMEEAEMGDGEENETG 3972

  Fly  5090 QHVKEPKNSDKTTLDNATEEQSKKIQHQEDEPPNEEEIEAENVDELMEAEEPAVDPEDDAELEQL 5154
            |.::..:.||:..:...|.|::::.:.:|     :.|.|.....||.:|.|.....:|..|:|..
 Worm  3973 QQMENAEISDRQMVGKGTIEEARQTKREE-----KREEEKRKRRELKDALEGTAGEDDGGEVEDE 4032

  Fly  5155 GAEKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETTAHSNSEILLDKSSHAEDL 5219
            .||:.::                                        ||.:             :
 Worm  4033 NAEEIKE----------------------------------------AHIH-------------M 4044

  Fly  5220 SSAEQIELRQQYQKQLTTFRVAQPEHED-----------------YETWQGISNRMTQNARELCE 5267
            ::.:...:.::..|.|.|..:..||.:|                 .|.|..:|..:...|.||.|
 Worm  4045 AAHDMFHVIEETTKDLVTGMIDDPEDQDPRSSQQGPSDRPTNSKADEQWAAMSRTVGMLAAELAE 4109

  Fly  5268 QLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKS 5332
            .|||||||.:..:::||||:|:|:||:::||||||::|||:||:||||.|||:|:|.||:|||:|
 Worm  4110 NLRLILEPQRANKMQGDYRSGKRLNMRRLIPYIASEYRKDRIWMRRTKRAQREYQILIAVDDSES 4174

  Fly  5333 MHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQIIL--NHTEQFDGPRLVNALNFAQDK 5395
            |:.|.....|.|::.:|..||...::||:|:.|||.....|:  ..........::..:.|:|.|
 Worm  4175 MNENGIHQNTCESVCIVEDALRRCDAGRVSVCSFGADVNTIIPFGEASASSSIEMLKQMTFSQKK 4239

  Fly  5396 TKIAGLLNFIRTA--NAEESGTGGDNGLFENLLLILSDGRNIFSEGAQNVKNAIKLARLQRIFLV 5458
            |   .||..::||  ..:|..||..    |.:|:::||||...|:||..|: |:..| ||.:.::
 Worm  4240 T---DLLLLLKTAKQQLDEMRTGTS----EQMLIVISDGRGALSQGADKVR-ALYSA-LQGVTVL 4295

  Fly  5459 YIIIDNPDNKNSILDIQHVAVNADGSVNINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELV 5523
            :|::|:  .|.||.| ..||...|..|.:..||..||||:|.:|:.:.|||.|::|::|||||:.
 Worm  4296 FIVLDS--GKKSIED-HTVASFKDNKVVLTPYLALFPFPFYALVKSVQQLPSVIAESIRQWFEMT 4357

  Fly  5524 NS 5525
            .:
 Worm  4358 TT 4359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1426/5516 (26%)
P-loop_NTPase 315..505 CDD:304359 47/219 (21%)
P-loop_NTPase <887..972 CDD:304359 35/85 (41%)
P-loop_NTPase 1147..1283 CDD:304359 89/136 (65%)
P-loop_NTPase 1454..1603 CDD:304359 79/149 (53%)
P-loop_NTPase 1795..1946 CDD:304359 80/153 (52%)
P-loop_NTPase <2335..>2378 CDD:304359 22/43 (51%)
Prothymosin 4843..4920 CDD:281265 22/77 (29%)
PHA03151 4856..5060 CDD:177546 47/204 (23%)
MttA_Hcf106 <5046..5166 CDD:294511 27/120 (23%)
vWA_midasin 5261..5526 CDD:238737 112/270 (41%)
F55F10.1NP_001263748.1 MDN1 70..4355 CDD:227596 1423/5495 (26%)
P-loop_NTPase 83..197 CDD:304359 45/192 (23%)
AAA 371..>400 CDD:99707 22/29 (76%)
P-loop_NTPase <502..587 CDD:304359 37/100 (37%)
P-loop_NTPase 747..883 CDD:304359 89/136 (65%)
AAA_5 1041..1175 CDD:285029 79/148 (53%)
P-loop_NTPase 1376..1518 CDD:304359 80/153 (52%)
P-loop_NTPase 1687..1883 CDD:304359 73/253 (29%)
Prothymosin 3620..3713 CDD:281265 35/96 (36%)
PTPRCAP <3829..>3891 CDD:292341 20/90 (22%)
vWA_midasin 4103..4360 CDD:238737 112/270 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354827679
eggNOG 1 0.900 E1_COG5271
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1317 1.000 Inparanoid score I70
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D138219at2759
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 1 1.000 T475412
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.941 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R702
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.