DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and mdn1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_002940362.2 Gene:mdn1 XenbaseID:XB-GENE-958471 Length:5545 Species:Xenopus tropicalis

Alignment Length:6047 Identity:1886/6048 (31%)
Similarity:2935/6048 (49%) Gaps:1080/6048 (18%)


  Fly    32 LQKFIKKQKYVPQDVERLFRSLSEQLPLPAYTVPIAASFEEQLLLLL---SMALRWDSASQRFH- 92
            |.||:.||.:.|||.|.:...||:.|.....||.|.......||.||   :.::|  :..|..| 
 Frog    22 LNKFLSKQIWSPQDREAILNILSQLLLDKECTVLIGRQLRPLLLDLLERNAESIR--AGGQINHD 84

  Fly    93 TYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEKQQSNGSLPSKKSKNGNHAADNLDDLELIK 157
            .::..|||:|||:|...|...||..||.:....|::.    .|.|..|....:....:...:|::
 Frog    85 LHERLCVAMSKLINCYPDVLPFALRYFQNASPVFQRL----FLESCDSGAVRYGRRRMKLRDLME 145

  Fly   158 CCFQLLKSDTPYFRELWDWSSFIATYTHNSSSPKTQLYCNYIVAMLTNMS-APQLNSLNEKIST- 220
            ..::.||.|...||||||||  :......|.....:.|..:.::::|.|| |.:...|.:..|| 
 Frog   146 AAYRFLKRDMFSFRELWDWS--VCLPLLKSHDLTVRWYTAHCLSLVTCMSDANKQIFLKKMFSTD 208

  Fly   221 ---KTRLEF-DQEREQAWNTARNTLCSYTPDASDQLLNLHLH--------GINKSVTNIEGVLLP 273
               ..||:| |:.:.|  |..|..|.:.....:.|:.....:        .:..||..:.|::||
 Frog   209 ELINFRLQFLDELQNQ--NLERGLLMANQEKTTWQIKKCQHYTQGQIVSGDLCSSVVPVCGIILP 271

  Fly   274 ------TFNEENLEFYASTDGCYDRIVKVDSTVVNLRSIALGVAAAKPICLSGPVGCGKTTLIEY 332
                  ..:||::          .::|.|:||..||.|:||.|:...|:.|.||:|||||.|:||
 Frog   272 KKQSKGQHSEESI----------SQLVLVESTCKNLHSLALAVSYQNPVLLEGPIGCGKTALVEY 326

  Fly   333 LARKTGRICPKPNEIESREKALKKAEEEEQLLTPKKKAKTTGSKRKLEEVPLEELLDLGETTKKS 397
            ||..|||  .:|.:|                                                  
 Frog   327 LATVTGR--HQPPDI-------------------------------------------------- 339

  Fly   398 GFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLTQAVMHGYWLLLEDLDAATQDTYTILSSL 462
              |::|||||||||||||.|||||:||||||.||.|||||.:|:|:||||:|.|..|..::|..:
 Frog   340 --LKVQLGDQTDSKMLLGMYRCTDIPGEFVWQPGTLTQAVANGHWILLEDIDYAPLDVISVLLPV 402

  Fly   463 LERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASN---SSQKSLYSLLDKYLYTINILPLSRNEL 524
            ||...|.:||..|.:|:.||||||.|.|...|:|.   ..|.:..|||||:...|::..:||.||
 Frog   403 LENGELLMPGRGDCIKVAPGFQLFATRRLLSSSSGVWYRPQNTHASLLDKHWTRIHLGNMSREEL 467

  Fly   525 CKMVSINYPKLSTVANRIVDVFLTFSSGNHTSADNLRQQESGDKADNTEQYVALPFEQ-VPLTSS 588
            .:::...||.|..|.:|::|:::..:...|.:..:|..:        .|..:..|.|| ||   .
 Frog   468 KEVILKLYPNLELVTDRLLDIYIQLTGDKHLAMSDLETE--------AEALLQKPLEQNVP---R 521

  Fly   589 PN-SGRLVSTRDLVKLCHRSNPQFSVTSSECAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAKLG 652
            || .||.:|.|||:|.|:|....|..|:|..|..:|..|:|.|.:.|.:...::.:...||:||.
 Frog   522 PNLEGRGLSLRDLLKWCNRIIHNFDSTASSTALNIFHEAMDCFTAMLSKPGSRLRMAEVIGSKLN 586

  Fly   653 IIRSRCEHFANEYKPDVEFGLEHIKIGRASLLAKSDLNNSENEDISEQDLKRQKLSQQTRRAIGK 717
            |.:.:.|.:...|||::......:.:||..:|.|                       ||...  .
 Frog   587 ISKQKAEFYCQLYKPNISVRELDVSVGRVEILRK-----------------------QTETV--H 626

  Fly   718 VSNKRTTFSFTRLASCILERIAVCVTHSEPVLLVGETGVGKTSSVQYLAERTEHKLVVVNMNNQS 782
            |..:|.||:.||.:|.::|::||||...|.||||||||.||||:||||:.....:|.|||||.||
 Frog   627 VHRERITFAATRPSSVLIEQLAVCVNKGESVLLVGETGTGKTSTVQYLSHVAGQRLRVVNMNQQS 691

  Fly   783 DVSDLVGGFKPVELNYVLAPLRNEFEYLLCETFNQEKNLQFLRLFATHYNSGRHAVIIRTMINIC 847
            |.:||:||:|||:...:..|||..||.|..:||::::|..||....|.|...|...:::.|.:: 
 Frog   692 DTADLLGGYKPVDHKLIWLPLREGFEELFAQTFSRKQNQTFLGHIQTCYRQKRWQDLLKLMQHV- 755

  Fly   848 LQVAKNPELKANK----LLPRWQTLREKLQKLQMQLDKSIN-ISFAFIPGSLVNCISNGDWVLLD 907
            |:.|.| :::..:    |..:|:....:|.:.|.|:..:.| :.|||:.|:|...:..|:|:|||
 Frog   756 LRSALN-KVQTGEAEFLLKEKWEGFSLRLNQAQQQMRMTENAVLFAFVEGTLAQAVKKGEWILLD 819

  Fly   908 EINLASAETLECLSTILEP-EGSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNR 971
            |||||:|||||||..:||. .||:|||:|||..|:.||||||:||||||.||:||::||.|||||
 Frog   820 EINLAAAETLECLCGLLEGISGSLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRNR 884

  Fly   972 FTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHNIVQLYKSLRKLSELQLNDGLGNRPVYSLRT 1036
            |||.:|:||..:.||.:|:.|||....:.:..|..|:..|.::||.|..:|.||.|:||.|||||
 Frog   885 FTELYVEELENEGDLQILIMDYLRGLNVSKTVVQGIISFYLAIRKKSSAELVDGTGHRPHYSLRT 949

  Fly  1037 LCRSLRICARNLCGSIERNLYESFCLSFLTQLDPNSHHVVLLLIQNALL-SNVKAILSKQLPQ-L 1099
            |||:||..:.|.|.|::|:|||.|||.||||||..||.|||.||:..:: .|:|.:||:.||: .
 Frog   950 LCRALRYASANPCNSVQRSLYEGFCLGFLTQLDRASHSVVLGLIRRYIVQGNIKHLLSQPLPEPR 1014

  Fly  1100 GENYLDFEGYWIQPGNLEPQPCTHYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDY 1164
            |..::..:||||..|:.:|.....||||.||..||:||.|::|.|..|:|:||.||.||||||.:
 Frog  1015 GSRFVQIQGYWIPVGDKDPAIDESYILTYSVNLNLRDLVRVVSAGTHPVLIQGETSVGKTSLIRW 1079

  Fly  1165 VARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKLTFREGVLVQAMRHGFWIILDELNLASTDIL 1229
            :|..|||.|:|||||||||:|||||.|.:|:.|||.|:||||:.|||.|:|:||||||||.||:|
 Frog  1080 LACASGNHCVRINNHEHTDIQEYIGCYTSDVSGKLIFKEGVLIDAMRKGYWVILDELNLAPTDVL 1144

  Fly  1230 EALNRVLDDNRELYIAETQTLVKAHPNFMLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPRE 1294
            |||||:|||||||:|.|||.:|||||.|||||||||||||||||.|||||:|||:||||.::|..
 Frog  1145 EALNRLLDDNRELFITETQEVVKAHPRFMLFATQNPPGLYGGRKVLSRAFRNRFVELHFDELPSA 1209

  Fly  1295 ELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTS----KQVF-TLRDLFRWGNRYTHADKSLHD 1354
            ||||||.|||.:||:|..|:|..|.:||.:|:.:|    |..| ||||||||..||..::::..|
 Frog  1210 ELETILHKRCCLPPSYCNKLVAVMLELQSYRRGSSVFAGKHGFITLRDLFRWAERYRLSEQNEKD 1274

  Fly  1355 DNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTLFANFRKKLDLQTLF---DIQTDRESSSMVS 1416
               |||.|||..:|:::|:.:||..||.|:|.|.|...|:|:::.|.:|   .:|...:|.| |.
 Frog  1275 ---YDWLQHLANDGFMLLAGRVRKPEEEEVILKVLKKCFKKQVEPQHIFSRGSVQRQLDSLS-VQ 1335

  Fly  1417 RKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKTTVCQLLASIADVQLR 1481
            :.|:|    |:. ..||||:.|.|:||:..:||:|.|||||||.|||||||:|||.|::|...|.
 Frog  1336 QDIVD----FRF-SHIVWTQGMRRLAVLVGRALQFGEPVLLVGDTGCGKTTICQLFAALASQTLH 1395

  Fly  1482 ILNCHMHTEGADFLGGLRPCRGK-------ESTQLFEWADGPLIYAMQEGSYFMADEISLAEDSV 1539
            .:|||.|.|.:||||||||.|.:       |.::||||.||||:.|::|..:|:.||||||:|||
 Frog  1396 CVNCHQHMETSDFLGGLRPIRQRSKDKDDVEYSKLFEWHDGPLVLAIKEDGFFLMDEISLADDSV 1460

  Fly  1540 LERLNCILEPERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNPGGDFGKKELSPALRNRFT 1604
            |||||.:||.|:|::|||||. .|.:.....::.|...|:.||||||||||||||||||||||||
 Frog  1461 LERLNSVLEVEKTLVLAEKGS-GEDETEEVEILTAGKQFRILATMNPGGDFGKKELSPALRNRFT 1524

  Fly  1605 EVWCLPSDNKEDLIEIAYNCMRRQKEHENQAINTHKVAEYLVDVVLHIRDTNDKFK----FSVRD 1665
            |:||..|:::.||.||..:.:.......:...|...:|:.::|.:..:  ||..|.    .||||
 Frog  1525 EIWCPQSNDRHDLAEIIKHNLHTGLSLGSSYCNGADIADLMMDFIEWL--TNQDFGRRCILSVRD 1587

  Fly  1666 ILAWANYMVSNAKLSFAEQAIFGLETIFLDALEMLPHES-QEQVELLKSNIVKQAIKQASLILQE 1729
            ||:|.|:|  |..:...:..........|||:....|.: ...::.|.|.....:.:.|:...|:
 Frog  1588 ILSWVNFM--NVMVGDKDAVNSNAPGADLDAVTAFVHAACLVYIDGLGSGTTFTSAEAATFARQQ 1650

  Fly  1730 --KFTLEELSE---------------KRGTEVEL---NECRFGIRPFFIDV----NQERLTSAKE 1770
              :|..|:|||               .:.|:.::   .:| |||.||:|.:    .:.::|    
 Frog  1651 CMRFLREKLSEILSLTEDVHSELKLYDQATQRKICWREDC-FGIHPFYIPIGPYFQENKIT---- 1710

  Fly  1771 DFLFDAPTTKQNLFRLLSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADL 1835
            |:..:|.||..|..|||.||.|.||::|||.|||||||:|.::..|.|..:|||||.|.||:.||
 Frog  1711 DYALNAETTSMNAQRLLRALQLNKPIILEGSPGVGKTSLVTALAKASGNCLVRINLSEQTDVTDL 1775

  Fly  1836 FGTDLPAEDNLLESNTAATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLD 1900
            ||||||.|..           :...|.|||||||:||||.: ||:|||||||.|||||||||..|
 Frog  1776 FGTDLPVEGG-----------KGGEFAWRDGPLLSALKAGH-WIVLDELNLASQSVLEGLNACFD 1828

  Fly  1901 HRGEVYIPELNKSFHLAGS-TRIFACQNPLKQGGGRKGLPQSFLNRFTKVYLRKLSTEDLLHVVT 1964
            ||.|||||||..:|.:... |:||.||||..|||||||||:|||||||:||:.:||..|:..:. 
 Frog  1829 HRAEVYIPELGMNFQVQHERTKIFGCQNPFHQGGGRKGLPRSFLNRFTQVYVDQLSFADMEFIA- 1892

  Fly  1965 EKYGKYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSDSFDLGARLVRFSEQLDRGV-ASMEF 2028
                      |:.|..|              |..:..|         :|.|:.::|..| ...::
 Frog  1893 ----------NSLFPSL--------------GTSTVSK---------MVAFNNKIDHQVMVEKKW 1924

  Fly  2029 GYKGGPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAAFKDFLLTLYERMQLVYYQRMRCDQD 2093
            |.||||:||||||:.|||.|:...||       |.|:..|         :.:.|:|.:|||...|
 Frog  1925 GQKGGPWEFNLRDLFRWCQLMLEDQT-------PDSYDPA---------QHVFLIYGERMRTKPD 1973

  Fly  2094 KSYIRNVFSTVFLCDAEYLNQVSNDVALYWTADKVYLNDVVLSRKQADVLDLVNRQEQSPL---- 2154
            :..|.:|:..|:   .:.|.........|.|...|.|...||.|..           .|||    
 Frog  1974 REKIISVYKEVY---GQDLTPYLGTRYFYITPQNVQLGYSVLPRSC-----------DSPLSFSG 2024

  Fly  2155 ---LLDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVLSNR-----LCNTDIIDDSVT 2211
               ||....|.|:.:::.|.|...::|.|....|||.|:..|.:|:..     ..|:.:....:.
 Frog  2025 HLSLLHHSLQSLEPVMKCVQMGWMVILVGPAAVGKTSLVQTLALLTGHKLKIMAMNSAMDTTELL 2089

  Fly  2212 GSFQQIDLNRH----LEIIYKKVETLVFSCVQRAFVLHTQSEFVEQLWNNWSMYNKLAKV----- 2267
            |.|:|.|:||.    ||.:...|.|||...:........::|.:.:.|...|:.:|...|     
 Frog  2090 GGFEQADINRPWQQLLEQVGNAVTTLVRDSLLTTDASPDETEALLRSWTTMSLIHKPQSVGEAGS 2154

  Fly  2268 --TTEA--QQHSVLDELKLFSERLGSLGKIIEVLEATPQNCQVRAL-QQLAEIKSQLLLLQTYIK 2327
              ||:.  :...||.:::..:.||.:..|           .:..|| :|....|.|||      .
 Frog  2155 GITTDLLNKLEGVLVQIQRLNLRLNTFTK-----------TEFGALVEQFHSFKEQLL------H 2202

  Fly  2328 TADSLNTGGSFEWVDSQIVTSLKCGQYILLEHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQD 2392
            :.:. .:.|:|||||..:|.:|:||.::|:::||.|||:||||||.:.||.|.|.:.|:|:: ..
 Frog  2203 SVEG-QSSGTFEWVDGMLVQALQCGDWLLMDNVNFCSSSVLDRLNALLEPGGVLTMTERGVT-DG 2265

  Fly  2393 SAEVVYKSTNFRAFLTVDPKNGELSRAMRNRCVELSLSRDT----YSVDDLRAFVHEQGVREMEA 2453
            |...:....|||.||::||.:||:|||||||.:||.:|.::    ..:.|.:..:|..||...:.
 Frog  2266 SMLTITPHPNFRLFLSMDPSHGEISRAMRNRGIELYISGESEGMLLDLFDTKRLIHNLGVVGDDV 2330

  Fly  2454 IDCILRVHKGLSQ-LTEFNNYSISHLTQFAFLSAAYRRIGYELKRAIYVAAMEVYVYSANTDLMG 2517
            .:.::.||....: :|.....|:|.|...|.|.:...:.|..|:.:...|..||:: :....|..
 Frog  2331 CNALIAVHSETKEAVTGSPCGSLSALLHAAALISQQLQRGIGLETSFRSACNEVFL-NCQHSLAS 2394

  Fly  2518 YGLSYYQNKLREVVLAQTEVFEEVAVIQEDFLSDVILNSGNLNSLTLIKRQAVALKVLLDGYT-- 2580
                  |.::.|:|:::....  |...:..||| :.|...::.|..|....:....:|.||..  
 Frog  2395 ------QKRVHEIVMSKVSAL--VTAQEGSFLS-LGLWPDSVPSALLSCEDSAISTILRDGQVLV 2450

  Fly  2581 -----EGKIPQKLLASLFHEMEK--------------LKLDQR--NPQKLIRHFLYMLYESSAIG 2624
                 :.....:.|....|::.|              :.||..  :...:|.|.:..|.|.::..
 Frog  2451 YALNRQSLQHSRTLPLTLHDLRKASQSSPGDGLHFSAVALDSHWMDDPAVIAHSVQFLIERASTI 2515

  Fly  2625 DLELRHLYLQPWLSK------------DTAFQELSQ-----------NLYNCLQKRSNTDTGTLA 2666
            |..||..:|.....|            |.....|||           |:...||...:.:.....
 Frog  2516 DWVLRMRWLNHLAKKLTPDTDHIRTMIDAGAYALSQLYSSPIPKEISNVVKLLQTTISDEDYIPL 2580

  Fly  2667 NLPWNRKLIPRLRDYSTAESNSE--------LNPLNLSALLLA-RLVVDIIPVSSVTTVQQMNAL 2722
            :..||.:.:..:.::...::.:|        ||.:...|:||| |.....:....||.:::.:||
 Frog  2581 DPRWNMQYLEIVTNFLKFDTGTEPAKQLLNLLNSVTNRAVLLANRERQYFLEKPEVTNLRETSAL 2645

  Fly  2723 QYSQALCK-KQVTEKYANHLLANFSSFLEVLHTSLLEDLETADLDL-----PQYAHLVTRFHWFN 2781
            |.:....| ..|.:...:.::|:.::|.::....|.|.|:::...|     .:..|.:.   |.:
 Frog  2646 QIAIKFHKDPSVNQDLPHPVVAHLAAFFDLWDMFLNECLQSSHSPLRNDAVTEVLHCIL---WRD 2707

  Fly  2782 RILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHLL--VPLIELTAKSG--CARMLTIQDRTLKI 2842
            |.     :|:.....|....:..|.||:.|:.||.|  :|.|.:..::.  |..   :|..:..|
 Frog  2708 RF-----RKVCETVSLDSAGLALLALHWCWVVKHSLKQIPKIFIGLENSRLCQE---VQSVSSSI 2764

  Fly  2843 KKYI-EETRRPLNVTCKIYSKQFTQFQPYYQDQQIQRHIELDDLEKLLSVVPSYGNLEL------ 2900
            :..: .:::.|.:|  |:......:..||.::...|      .:|:|.::..|....||      
 Frog  2765 QDCVSSDSKVPTSV--KMLQNILGRPLPYKEEWLAQ------CMERLSTLSASLDIFELRPVRGE 2821

  Fly  2901 SSWLKRWLLLQTDDANKWRSFLRKHTNGFQPKAFEISGSLRNETLQSHLQKLQTTLKEAQENSAE 2965
            |.||::            ...::..::|::.||         :.|.|.:..|:...:|.      
 Frog  2822 SGWLEK------------IHRMKAASSGWEIKA---------KILNSCVSILKANHREL------ 2859

  Fly  2966 IEMDLELDLNSIKTLLEAETEESESYIHPDGIPTNTPKLLIAALRELFMERLLTGTLRDDFDEQV 3030
            |..| ||.|:         .|...|::...||..:..|                ....:||..||
 Frog  2860 INRD-ELCLS---------IESHCSFLENCGIKLSLTK----------------DVHSEDFGGQV 2898

  Fly  3031 NPLYADQLLTLNSN------------LWHCLKTLESANRTEITNAWIELKNEVNELQNY--DEFA 3081
            |   ::.|:.|:|.            |||...|.:..:.|.....  .||:::.:|..:  .|..
 Frog  2899 N---SEDLIQLSSKVQMWPGMEYLKLLWHYKVTADILSHTYYGRK--NLKSDITQLVTFCLKETP 2958

  Fly  3082 VLLEKIGGGY------------------KGLRSYQRQYRNSVQCYQLENLSTRLDCVQGPSEEGS 3128
            :.::.:...:                  :.:.|....:.||......:..|:..|...  .|:|.
 Frog  2959 ISVQHLQALFYLTEVPEMSSEVISLLWPELMSSVFASFWNSTVTTDPDYWSSWKDAFS--PEDGK 3021

  Fly  3129 TDIS-SQFCYRGPAL--SGVILSLICQP-NGQLRSVP-----LSELL-------EWRSALQQTRH 3177
            ...| .:...:|||:  ..|.....|:. ....:::|     |..||       ||...|.:.|.
 Frog  3022 IVRSLMEPSVKGPAILSKAVFSKCFCEVLTSSSKAIPWNVSGLPVLLSSHVSLGEWSERLNRLRE 3086

  Fly  3178 L---IWENSQLLT--------SRYSGEV--NNLLQAKENARQLLKE--LEYVRKLSEKEQKA--- 3224
            :   :|.|..:.:        ||..|.:  ::.:..|:...|.::|  |:|...|..|:..|   
 Frog  3087 ISSTLWSNMTVSSMANFRSTDSRLQGLLLYHHFIALKDLVPQSIQEEFLQYCDHLPTKDLSAYHY 3151

  Fly  3225 ---------NQGFENCAKELEKM----IEKLEKEENNNASMTKDFEVSLTNALVGAIELCLLTNT 3276
                     ||  |....:|.|:    :::...|.:....::...........:|.:::.:....
 Frog  3152 IQDILRDWMNQ--EMLPVDLLKLWLICLQQFYAEVDGTMHVSDSAHKGSLWVNLGLLQIQIWLPQ 3214

  Fly  3277 PLIDPVEKNRLKNEYIAEDI----------DCLSTLTTAYDFMKIAMKYRHFGEEIYSELELRLR 3331
            .:.||..|.:.|.:|..:::          |..|:|.|.....         .|.:...:...:|
 Frog  3215 TVFDPAVKRQHKLKYTKDELHELECEWRVRDLSSSLLTGKSLE---------DESLQKHMHPHVR 3270

  Fly  3332 TALQRQQQ-------LSQKLALRSEKCLYASLVQDITHFLHSNGDCESLYKLFQLIHSEWENFQG 3389
            ..|||.|:       |::|.|.|.....|..|.||:.::|.|.....|:..|...:         
 Frog  3271 ILLQRIQKLKKSIADLTKKQAYRPRNPTYDCLYQDVHNYLSSIAKTSSVQDLSSRL--------- 3326

  Fly  3390 LHVATSAQLKSS---IEVLGKLDLWLANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLESL 3451
            |...|....||.   ..:|.:...|..:..:|.......|| .|.|.|.|:..::.|::.|   :
 Frog  3327 LKTLTGKSSKSRQALQNLLSEEATWQQSHHKFRKRLSEEYS-MYPDLVTPLCAAILQMQHG---M 3387

  Fly  3452 KVIFTRV--QQAGSVSQAEQMQQTIGDIVQFPS---QHPLVIRNS------RLYGLLAELPHSEY 3505
            ::|.:.|  .....:....::...:..::.|||   ..|..:.|:      ....:|..|.....
 Frog  3388 RLIASEVYISMNSVLISPSKIITLLNSLLAFPSVSESFPTYLSNADSLCSVSSLDILKSLKKLSQ 3452

  Fly  3506 EYFRLLKAKLSELSNYIALGRVIDETTFAAYDDALS--------------ICN---QTWQQEEHR 3553
            :|.......:::||:.:...:::..:........||              ||.   ..|.::|..
 Frog  3453 KYSSRTTHGVTDLSSCLTKEQLLVNSLLYLRSHVLSKGEMDQKSLKLFRHICQAIINDWDEQEEA 3517

  Fly  3554 RCQLKAEAESLYVTKTKGG----VDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKK 3614
            ..|.:.:..|||..:||..    .|:|   |.:|....||.: ::|||:.|::|:||..::.:: 
 Frog  3518 ERQRQKQESSLYKYRTKSHGEALPDNE---EEREFRKRFPLH-EKDFADLVTEPSLEGKMETEE- 3577

  Fly  3615 ASAKDKQSQIVVEEDYAFLARNFIDVMTRHTQV---------YYKEQPKSSKELELHLLAPYQAR 3670
              .::|:|.:.:     .|..:...||..|.|:         |:...|:...:   |.|:.:.:.
 Frog  3578 --PEEKESHVTL-----VLQSSMQAVMLIHQQLCLCTARSLWYHHNPPEHQAK---HYLSAFLSC 3632

  Fly  3671 FQVFANLHGHYKTALGSSLEERACNGLAFGLALQQKQLRD------IELEEGVSSSPYDFYKDSN 3729
            :|..|.|..|....:||.|.:..........:|.|..:..      |...||    |||||:..|
 Frog  3633 YQTSAALIEHLYPLMGSELNDHLLGSQLLAGSLLQNSISGNTATNLILQHEG----PYDFYQHPN 3693

  Fly  3730 ISEIQSCLDVMERIEKRVLEQLEQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLA 3794
            |.::|.|..:::.....:.:.||::|||..|..:.:||.||:..|..:|:.:...|.::|..|..
 Frog  3694 IPQVQQCQKILQNFTSAINKLLEEWPEHPALVQVLVVIERIQSFPLSSPLSKILNGLEILLAKAQ 3758

  Fly  3795 LWNEVAHRNNNLVSEEIEVAEFVQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYNLLQQFIH 3859
            .|.|.|:|..:|.....|:.:.:.:|.:|||..|...|....|:...:...:||.:|.|:::   
 Frog  3759 DWEENANRGLSLRKHLDEITQLIIQWRKLELNCWSLGLDNALARHVQKTTSHWFSVYQLVEK--- 3820

  Fly  3860 QKQLDHSYTDIKLAEQRFAQDHLLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQG 3924
                                 ||   |:..|.:.|.|..:.:.|:.|:|.|..|:|..||.||..
 Frog  3821 ---------------------HL---QEEHEQEELLLQSLTKTLQAFIEGSTLGEFQSRLTLLLV 3861

  Fly  3925 FELYLHNVERAGKINGLPPLIAALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKD 3989
            |..::..:.::.|.:.   |.:.|.||..|:.|||..:.......|:|:||:|||||||..:: |
 Frog  3862 FHCHVLLIPQSPKKDS---LCSVLWNLYHYYKQFASTVQARITELRNPLEKELKEFVKISRWN-D 3922

  Fly  3990 LSYFSMRNSVASVHRNLNKFLKEYRLSIQEKISEVFQPKDSTAKDYTFGTDKGKGLRNYNKIKYL 4054
            :|::|::.||...||.|.|::|::...:.|..|...                             
 Frog  3923 VSFWSVKQSVDKTHRTLFKYMKKFETVLCEPCSPAL----------------------------- 3958

  Fly  4055 HTERQQFVASEKLLEKFAIQEEFLSDNTLLQRLDKHFRTARHVVKETLGQVPYGELITELDDL-- 4117
             ||.    |.|:.||....|.|..:....||:|......|  |:||....:..||.|...|.|  
 Frog  3959 -TES----AQEERLEYQEDQRESAAKINQLQQLCLTLTAA--VIKEEQTLLSCGESIYSTDSLQA 4016

  Fly  4118 ----LASQLER--CEHLR--------------------------SLNVDRSKERPQQKQEAKQIL 4150
                |.:::::  |:::|                          :|.||.:.::.:||.:||.||
 Frog  4017 RLPILTNRMKKLCCKYIRNNAMPSLFDSLNEFAEGIIASVTELQNLTVDHNADKEKQKSQAKHIL 4081

  Fly  4151 QQKRKALTDLFKMLHRLGANYKTGLLELSLRNEFEDFQLPPYSIRSMLPRLHPTA---QQLDEHL 4212
            .||::||::|||||.:.|.:|:.|:.....:|..:...|.|..:.|.|...:.|.   .:|...:
 Frog  4082 MQKQRALSELFKMLTKTGLSYRKGIAFTRTKNLQDMLCLHPLDLHSALAISYNTLGTDSKLLAEI 4146

  Fly  4213 DL-------YYMKSVFKLKLLQNIMLTPLSELGPPNIERIKGFAVDLFLLVQQQREHLSGSTKE- 4269
            .:       |:.:|:.:...|...:|.|..|:|..:|||.|||:..|..::.:||..|:..|:: 
 Frog  4147 SITWDGCQKYFYRSIARSSRLTTSLLAPAKEIGLGSIERCKGFSGHLLKILVKQRTSLTILTEQW 4211

  Fly  4270 ---------LHELRNSLDS-------------------------------LRKL----------- 4283
                     :||:.:.:::                               |.:|           
 Frog  4212 IIMRNLLSCMHEIHSRMENGNEYRIAFPPQDGVQQWVERLQHLTMQCTMVLEQLLWFIECCPIQE 4276

  Fly  4284 ----------AEIIPQADINPSTLNFVKS-----ADIAMEIKQHLRQIHYVLKQWKLLLSCAPSS 4333
                      ||||.....:||| :|:.:     :.:|..:......:|...:.|:.|.|.....
 Frog  4277 NLSSKNMGDQAEIIKSEVRSPST-DFLSAGMNCPSPVATSLLPSACTMHKSDQNWQQLNSAVTKK 4340

  Fly  4334 FIEESENRLLVRKISLAQSEL-------HSLCIQILNSSQELLNELNNANLEYLSSE-------K 4384
            ..|..:.:..:.||.....|.       ...|...|::.|::.:||.....:::..|       :
 Frog  4341 LTEIKQTKAKMDKIRQQSCETLFYSWNDFEACSSALDTMQDIAHELREVESKFVLPETDVKEAAQ 4405

  Fly  4385 CVTYQKSYAEIQENIKKTLELLRTGQNDYLPLAQPIVELLDSVQLKNHTEIAPEAI-DLANADTE 4448
            .:|:.||...|::.::..:......::          .|....:.|.:.|...|.: |.:|   :
 Frog  4406 YMTFLKSLHYIRDEVRNAMREFTLWKS----------RLQAMGRAKRNQESDEEYVKDFSN---Q 4457

  Fly  4449 LANIAHSVLMSMQKIYKHHVKTDEVNQNGEA--KEQDEESKEALQEQHLKKCLTGELTSDWQQLS 4511
            :.:...|:|.::|.:...  |:|:.|:..|.  ||.:|.|.:.|.:..:.|.||.:|.||.:.|.
 Frog  4458 VESTIKSILCAIQNLVVK--KSDKENKESEVAEKEDEETSDDRLPQDLITKLLTEDLCSDLKSLQ 4520

  Fly  4512 LPRVLGKLSNVLLVLKHSHFEG--KDKLL----CVRRAIGLLPVLEQYQLLADYLLLQQLATHKV 4570
            :..::..:|.:|..|| ::.|.  |||..    |....:.|||:|..|..|..:.|...||||:.
 Frog  4521 VHLIISAVSELLERLK-TYGEDCIKDKYTFFNQCCGLLVRLLPMLSTYSDLILFYLSLSLATHRS 4584

  Fly  4571 SAKMLSIVLTVFVEIGSKGFCVPPDLMQDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQL 4635
            :.|:.||:..:|.|:..||||:|.:|:::..|:...|..:.||.|:.:|.|..|.|||||:|||:
 Frog  4585 TGKLFSILAHLFTELAQKGFCLPKELIEEAAGEGATEFHDYEGGGIGEGEGMKDVSDKIENEDQI 4649

  Fly  4636 DDA-KRPEDRKDEGDKQEPDCKEE-KGIEMSDDFDAKMQD--VEKPEEDDSGESEEEEDLNKEMG 4696
            :|. |:.||::.:....:||.||| ..||||:|||.|:.|  ::|.||:|...|:||| |:|:||
 Frog  4650 EDTLKKGEDKEKDDPNNKPDVKEEDNAIEMSEDFDGKIHDGELQKKEEEDESNSDEEE-LDKQMG 4713

  Fly  4697 ETEEG-AEKLDDQIWG--DDEEEKPEEEQEPDMNEE-----DQGKGSKDEKDAHNDLDTKNDAAK 4753
            :.... |:|||:::||  ||:::..|.|.|.|..||     |.|:.....||.:.|.|.|   :|
 Frog  4714 DLGNAEADKLDERLWGEDDDDDDDDENEDESDKTEETGPGMDMGESELVAKDDNLDADNK---SK 4775

  Fly  4754 EDGKDEHEKDGLDATNEPSGEDKR-KEQAKDI-------DDMKDPEMDEEQTNAMHNELEEPPEP 4810
            ||.|.|             ..||| :|||:|:       :.:.:.|.||.:|:..|...|..|||
 Frog  4776 EDKKQE-------------VRDKRDEEQAEDVPNKQQIHEQIDEREYDENETDPYHGNQENKPEP 4827

  Fly  4811 EEMDLGD---MNNVDEGH--DDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEEGDPQ 4870
            |.:||.|   :.|.:|.:  |:::|...:.||:||:.     :|.:..:.|..||  .:|||.|:
 Frog  4828 EALDLPDNLNLENEEEKNSGDEKEEGNEEGNPYDIEE-----KPLDVDDKDKQDE--GHEEGRPE 4885

  Fly  4871 SDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDDSKPEDSPEDSKEEKE 4935
            .: .||...|.....:..||:.|:..| .|:.|::|...::..:.|:|::...|:...|:..:.|
 Frog  4886 EE-QDSNATEKNASEQTGEEEDGKDTE-NPDQEENEQNEEENKQNEEENELPVEEDKMDTGVKDE 4948

  Fly  4936 EKR------------EEKPEEHSQSKDKASK----------EENVQSMPETDQSSSADQVQQPQD 4978
            |.|            ||.||:.....|...:          |||:||....:.:.||        
 Frog  4949 EDRLPADQGILPKAEEETPEKEEGIADSTERMEHDSCGQTAEENLQSESAAELAGSA-------- 5005

  Fly  4979 PDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQG-----VAETQETVSQEDRKNERQTQE-KRK 5037
                     .|::..:|:.|.|.|:....: ||:.     :|..:|::        :.||. |||
 Frog  5006 ---------SEKDDAKEEHGTGTADASQSE-GHESKLMARLASQKESI--------KTTQSVKRK 5052

  Fly  5038 QGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMDQTEAEEYQHVKEPKNS-DKT 5101
            .|::::|||||:..|...|:|:.:|...:..:|.|..:.|     ..:|:.|:|:|:...| |..
 Frog  5053 PGQSDDERSLGDHSQQVHKRLRIMDSSSEMTDSSDRPEHK-----SGQADAYEHIKQDSVSYDVQ 5112

  Fly  5102 TLDNATEEQSK-----------KIQHQED----EPPNEEEIEAENVDELMEAEEPAVD-----PE 5146
            |.|.|::||.|           |..|:||    |||.:|::||.:|::| :.||...|     ..
 Frog  5113 TYDVASKEQEKAMHPMNEDNGEKNPHEEDAMEMEPPLDEKLEAIDVEKL-KPEELTSDLSKTQGP 5176

  Fly  5147 DDAELEQLGAEKTEQKSDKPSKTEKSKEQLETPEGMEIEGEVVLTMTVPRSSETTAHSNSEIL-- 5209
            .|||||              |:..|::|.::|.|..:..|:      ..||:|::.|:..:.|  
 Frog  5177 GDAELE--------------SQIAKTEENIDTAERSQETGK------AERSTESSIHTALQFLTN 5221

  Fly  5210 -LDKSSHAEDLSSAEQIELRQQYQKQLTTFRV-----AQPEHEDYETWQGISNRMTQNARELCEQ 5268
             :::.:|..:       |||:..:|||..:::     .:.|....|.||.........:::||||
 Frog  5222 AIEQVAHNPE-------ELREMLEKQLEVWQMQSVSSVEEEKTAAEMWQRYLLLTAPLSQQLCEQ 5279

  Fly  5269 LRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKSM 5333
            ||||||||:..:||||:|||:|:||:|:||||||||||||||||||||::|.|:|.:|||||.||
 Frog  5280 LRLILEPTQAAKLKGDFRTGKRLNMRKVIPYIASQFRKDKIWLRRTKPSKRQYQICLAIDDSSSM 5344

  Fly  5334 HHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQIILNHTEQF---DGPRLVNALNFAQDK 5395
            ..|:||.|..|:::::..||||||.|::::.||||:.:::....|||   .|.|:::...|.|.|
 Frog  5345 VDNHSKQLAYESLAVIGNALTLLEVGQIAVYSFGESVKLLHPFHEQFSDQSGSRILSLCKFQQKK 5409

  Fly  5396 TKIAGLL-NFIRTANAEESGTGGDNGLFENLLLILSDGRNIFSEGAQNVKNAIKLARLQRIFLVY 5459
            |.||..| :.:....|.:..:...|.....||||:||||.:|.||...|.:|::.||...||:::
 Frog  5410 TLIAQFLESSVPMFAAAQQLSLSSNPETAQLLLIVSDGRGLFVEGKDRVTSAVQAARNANIFIIF 5474

  Fly  5460 IIIDNPDNKNSILDIQ-HVAVNADGSVNINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELV 5523
            ||:|||.:|:|::||: .:...|.....:.||::.||||:|:|:||:|.||..||:|:|||||||
 Frog  5475 IILDNPTSKDSVMDIKVPIFTEAGAMPKMISYMEQFPFPFYIILRDVNALPETLSDALRQWFELV 5539

  Fly  5524 NS 5525
            .:
 Frog  5540 TT 5541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1806/5752 (31%)
P-loop_NTPase 315..505 CDD:304359 79/193 (41%)
P-loop_NTPase <887..972 CDD:304359 56/86 (65%)
P-loop_NTPase 1147..1283 CDD:304359 102/136 (75%)
P-loop_NTPase 1454..1603 CDD:304359 93/156 (60%)
P-loop_NTPase 1795..1946 CDD:304359 93/152 (61%)
P-loop_NTPase <2335..>2378 CDD:304359 24/43 (56%)
Prothymosin 4843..4920 CDD:281265 20/77 (26%)
PHA03151 4856..5060 CDD:177546 59/232 (25%)
MttA_Hcf106 <5046..5166 CDD:294511 42/141 (30%)
vWA_midasin 5261..5526 CDD:238737 133/271 (49%)
mdn1XP_002940362.2 P-loop_NTPase 309..428 CDD:304359 74/173 (43%)
P-loop_NTPase 630..>669 CDD:304359 23/39 (59%)
P-loop_NTPase 656..885 CDD:304359 112/231 (48%)
AAA 1061..1204 CDD:214640 107/143 (75%)
P-loop_NTPase 1062..1198 CDD:304359 102/136 (75%)
AAA 1366..1523 CDD:214640 94/158 (59%)
P-loop_NTPase 1368..1523 CDD:304359 93/156 (60%)
P-loop_NTPase 1735..1875 CDD:304359 93/152 (61%)
P-loop_NTPase 2049..>2101 CDD:304359 15/52 (29%)
P-loop_NTPase 2149..2296 CDD:304359 59/166 (36%)
Prothymosin <4828..4910 CDD:281265 26/90 (29%)
vWA_midasin 5272..5542 CDD:238737 133/271 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354809262
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H39689
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D138219at2759
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.