DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and vwa8

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_012813198.1 Gene:vwa8 XenbaseID:XB-GENE-5820566 Length:1903 Species:Xenopus tropicalis

Alignment Length:1485 Identity:291/1486 (20%)
Similarity:496/1486 (33%) Gaps:431/1486 (29%)


  Fly  1113 PGNLEPQPCTHYILTESVKKNLKDLARIIS---IGKLPILLQGPTSAGKTSL-IDYVARRSGNRC 1173
            |.|..|.|.:|        .|::.|..|:.   :|: .|.|.||....:.|: :.|         
 Frog    70 PQNYIPDPLSH--------ANVQHLRWIMQKDLLGQ-DIFLIGPPGPLRRSIAMQY--------- 116

  Fly  1174 LRINNHEHTDLQEYIG----TYAADLDGKLTFREGV-------LVQAMRHGFWIILDELNLASTD 1227
            |.:...|    .|||.    |..:||..:...|.|.       .|:|...|..::|:.|..|..:
 Frog   117 LELTKRE----VEYIALSRDTTESDLKQRREIRAGTAFYIDQCAVRAATEGRILVLEGLEKAERN 177

  Fly  1228 ILEALNRVLDDNRELYI-----------------------AETQTLVKAHPNFMLFATQNPPGLY 1269
            :|..||.:| :|||:.:                       .:|..:|:...:|.:.|...|...|
 Frog   178 VLPVLNNLL-ENREMQLEDGRFLMSAERYDKLLQEHSRSELDTWKIVRVSEDFRVIALGLPVPKY 241

  Fly  1270 GGRKTLSRAFKNRFIELHFADIP-REELETILEKRCFIPPTYARKMVQCMTQLQQHRKNT----S 1329
            .| ..|....::||.......:| :::|:.:......:||....:::...|.|.....:|    .
 Frog   242 SG-NPLDPPLRSRFQARDIYYLPFKDQLQILYSAGSNVPPERISQLLSFATTLCSQESSTLGLPD 305

  Fly  1330 KQVFTLRDLFRWGNRYTHADKSLHDDNRYDWNQHLVEEGY---LVLSSKVRSQEEHELIEKTLFA 1391
            ..|..|....|           :.|......:|.::|..|   ::|..:.:|..|..|....|..
 Frog   306 FPVDNLESAIR-----------ILDSFPMMSSQRVIERLYPYTVILGKEGKSSVEGALKRFELKG 359

  Fly  1392 NFRKKLDLQTLFDIQTDRESSSMVSRKILDAIRNFKLRDDIVWTR------------NMTRMAVV 1444
            :.|..|.:: :..:.....:||.:      |..|..:.|..|..:            .:|:....
 Frog   360 SERSSLPMR-IEKVNLVHNTSSSI------AAVNIHVGDRTVCIKVPAGNMPLDLHTELTKFIKT 417

  Fly  1445 TAKALEFDE--------PVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPC 1501
            .:..|...|        .:.|:|..||||:.:.:..|.:...::..:..:......|.|      
 Frog   418 NSHELLLAEMMQSHMVKDMCLIGGKGCGKSVIAKEFAGMLGYEIEPVMLYQDMTARDLL------ 476

  Fly  1502 RGKESTQLF-------EWADGPLIYAMQEGSYFMADEISLAED---SVLERL-----------NC 1545
                 .|.|       .|...||:.|..||...:.|.|.....   |:|:||           ..
 Frog   477 -----QQRFTLPNGDTAWRQSPLVTAAIEGKLVILDGIHRVNPGTLSILQRLIHDRELTLYDGTR 536

  Fly  1546 ILEPERTVLLAEKGGISELDASPDFVVQAKSGFQFLATMNP---GGDFGKKELSPALRNRFTEVW 1607
            :|..:|...:.|:..:|:.:.....:......|:.:|...|   ||: .::.|.|.|...|    
 Frog   537 LLRNDRYQYIKEELQLSDEELQGRSIFPIHPSFRIIALAEPPVLGGN-SQQWLGPELLTMF---- 596

  Fly  1608 CLPSDNKEDLIEIAYNCMRRQKEHENQAIN------THKVAEYLVDVVLHIRDTNDKFKFSVRDI 1666
                        :.:......|:.|.|.|.      ..:..|.|:.|...:|||.|....|:...
 Frog   597 ------------LFHEIKSLTKKEEIQIITGMVPGVAKEAVEQLLTVTHKLRDTKDPTAQSLASS 649

  Fly  1667 LAWANYMVSNAKLS-FAEQAIF-GLETIFLDALEMLPHESQEQVELLKSNIVKQAIKQASLILQE 1729
            |:....:....:|| :.|:.:: ......|.  ..||:.::   ..|..|:....:::..:    
 Frog   650 LSTRQLLRICRRLSQYPEEGLYHAANKACLS--RFLPNLAR---STLHKNLADSGVEENIM---- 705

  Fly  1730 KFTLEELSEKRGTEVELNECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLF---RLLSALS 1791
              .||.:.|| ....|:|.....:....:.|:.........|.||  ...||::.   .:|....
 Frog   706 --DLERIQEK-DYSCEINSGILRLGNITVPVHNPNEKMKVPDVLF--YENKQHMMVMEDMLKDFL 765

  Fly  1792 LQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAE------DNLLESN 1850
            |.:.:||.|..||||..||:..                     |...:.|.|      |..::|.
 Frog   766 LGEHLLLVGNQGVGKNKIVDRF---------------------LHLLNRPREYLQLHRDTTVQSL 809

  Fly  1851 TAATERQIRSFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLDHRGEVYI-------- 1907
            |.....:....|:.|.||:.|.| |...:::||.:.||.:|...|..::: .||:.:        
 Frog   810 TLQPSVKEGVIVYEDSPLVKACK-KGHILVIDEADKAPTNVTCILKTLVE-SGEMILSDGRRLVA 872

  Fly  1908 --------PEL----------------------NKSFHLAGSTRIFAC---QNPLKQGGGRKGLP 1939
                    |.|                      |..|...|.  ||:|   .||         :|
 Frog   873 NLSKLDRRPNLIAIHPDFKMIVLANRPGFPFLGNDFFGALGD--IFSCHAVDNP---------MP 926

  Fly  1940 QSFLNRFTKVYLRKLSTEDLLHVVTEKYG-----KYFDQLNAYFLELLDQKAEGNLFEIYSGKES 1999
            ||.|                  .:.::||     ....:|.|.|.||.....:|.:...||.:| 
 Frog   927 QSEL------------------AMLKQYGPNVPDAVLQKLVAAFGELRSMADQGIITYPYSTRE- 972

  Fly  2000 SCKSDSFDLGARLVRFSEQLDRGVASMEFGYKGGPYEFNLRDILRWCDLLHNPQTGYILGASPSS 2064
                 ..::...|.:|..:....|....|.:..  |...:|:||  .:.||  :.|..:||.|::
 Frog   973 -----VVNIVKHLQKFPNEGLANVVRNVFDFDS--YNQEMREIL--MNSLH--KHGIPVGAKPTN 1026

  Fly  2065 FQAAFKDF----------------------LLTLYERMQL-----VYYQRMRCDQDKSYIRNVFS 2102
            .|.| |:.                      ||...|:.||     ||........::...|::..
 Frog  1027 IQLA-KELPLPEVSFTGHWTITQSGNVRRKLLCPTEKHQLTIKGPVYLNIQGYPLERHEARSLSF 1090

  Fly  2103 TV-------------FLCDAEYLNQ---------VSNDVALYWT---ADKVYLND---------- 2132
            |.             .:||.....:         ..|.|:||:|   .||.|..|          
 Frog  1091 TEEIAHWTLPINEVNIVCDVTMAEENGKNSLYVVTCNPVSLYFTRVNEDKGYFVDLYDIFPRTVG 1155

  Fly  2133 -------------------VVLSRKQADVLDLVNRQEQSPLLLDSQRQQLKQIIETVHMEKPLLL 2178
                               |:|..:|::|:          ||||:....|::|:.:...::|.. 
 Frog  1156 SVWQPFVTIAPMGHPLSGQVILHEEQSNVI----------LLLDTSSGALRRILLSGEEQEPPR- 1209

  Fly  2179 CGSTDSGKTKLID--ALC---------VLSNRLCNTDIIDDSVTGSFQQIDLNRHLEIIYKKVE- 2231
             .||..|..:..|  .:|         |......|:..|.|.:.|:...|.|..:|:.::...| 
 Frog  1210 -KSTWWGSKEAQDNYKMCREFSHKNWLVFYRENSNSLSILDVLEGTAHTISLPINLKSVFLVAED 1273

  Fly  2232 --TLVFSCVQRAFVLHTQSEFVEQLWNNWSMYNKLAKVTTEAQQHSVLDE-----LKLFSERLGS 2289
              .||.:...:.|:| |:...:|            |:.|...|.||:.:|     ..|.:|...|
 Frog  1274 RWLLVENKTNKKFLL-TKPLQME------------AEHTEVCQLHSLNEEPVSTGFGLTAEAEPS 1325

  Fly  2290 LGKIIEVLEATPQNCQVRALQQLAEIKSQLLLLQTY----IKTADSLNTGGSFEW 2340
            ....|...:..|:|..|...|::......|....:|    :...|.|:....:.|
 Frog  1326 NIHTISSDQLPPENLSVAVGQKIVSPNRILSDEHSYASIIVGFPDLLSPSEVYSW 1380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 291/1486 (20%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359 38/171 (22%)
P-loop_NTPase 1454..1603 CDD:304359 35/173 (20%)
P-loop_NTPase 1795..1946 CDD:304359 44/198 (22%)
P-loop_NTPase <2335..>2378 CDD:304359 1/7 (14%)
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
vwa8XP_012813198.1 AAA_5 98..254 CDD:285029 38/171 (22%)
AAA_5 435..596 CDD:285029 35/173 (20%)
AAA_5 769..916 CDD:285029 36/172 (21%)
vWFA 1711..1900 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.