DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13185 and Mdn1

Sequence 1:NP_001097279.2 Gene:CG13185 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_006537539.1 Gene:Mdn1 MGIID:1926159 Length:5589 Species:Mus musculus

Alignment Length:6146 Identity:1921/6147 (31%)
Similarity:2900/6147 (47%) Gaps:1209/6147 (20%)


  Fly    16 LELTANESEDNVFSQSLQKFIKKQKYVPQDVERLFRSLSEQLPLPAYTVPIAASFEEQLLLLL-- 78
            |.|.|.::|.:  |..|.:|:.|..:.|||.:.:..||::.|....||:.:.......||.||  
Mouse    13 LRLIAAKNEKS--SGELNRFLAKSVWTPQDRQCILDSLAQLLLDKDYTLLLGRQLRPILLDLLER 75

  Fly    79 -SMALRWDSASQRFH-TYQLECVALSKLMNFSLDAQRFAKSYFHDKPAPFEK--QQSNGSLPSKK 139
             :.|::  :..|..| .::...|::|||:....|...||..||.|....|::  .:|:.:.|.:.
Mouse    76 NAKAIK--TGGQVNHDLHERLSVSMSKLIGSHPDVLPFALRYFKDTYPVFQRLFLESSDANPVRY 138

  Fly   140 SKNGNHAADNLDDLELIKCCFQLLKSDTPYFRELWDWS----------SFIATYTHNSSSPKTQL 194
            .:......|      |::.....|:.....||||||||          :.:..:|.|        
Mouse   139 GRRRMKLRD------LMEAANIFLQHRQTVFRELWDWSVCVPLLRSHDALVRWHTAN-------- 189

  Fly   195 YCNYIVAMLTNMSAP-------QLNSLNEKISTKTRLEFD---QEREQAWNTARNTLCSYTPDAS 249
             |   :|::|.|:..       ::.|.:|.:..:.||..:   |:.|:|...|...:..:.....
Mouse   190 -C---LALVTCMNEEHKLSFLRKIFSSDELVHFRLRLLEEAQLQDLEKALVLANPEVSLWHKGEE 250

  Fly   250 DQLLNLHL--HGINKSVTNIEGVLLPTFNEENLEFYASTDGCYDR------IVKVDSTVVNLRSI 306
            .|.:..||  ..::.||..:.||:||..:....|..:......::      .|.|:|...||:.:
Mouse   251 PQYIQGHLVSADLSSSVAAVCGVVLPKLSSSPGEQASDRSSSLEQELALKSFVLVESVCKNLQLL 315

  Fly   307 ALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNEIESREKALKKAEEEEQLLTPKKKAK 371
            |:.||:...:.|.||:|.|||:|:|:||..|||                                
Mouse   316 AVSVASQNAVLLEGPIGSGKTSLVEHLAAVTGR-------------------------------- 348

  Fly   372 TTGSKRKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDSKMLLGQYRCTDVPGEFVWLPGVLTQA 436
                                  ||....|::|||||||||||||.||||||||||||.||.||||
Mouse   349 ----------------------TKPPQLLKVQLGDQTDSKMLLGMYRCTDVPGEFVWQPGTLTQA 391

  Fly   437 VMHGYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVKIEPGFQLFVTVRTNKSASNSSQK 501
            ...|||:||||:|.|..|..::|..|||...|.:||..|.:|:.|.||||.| |...|...|..:
Mouse   392 ATKGYWILLEDIDYAPLDVVSVLIPLLEHGELLIPGHGDCLKVAPTFQLFAT-RRLLSCGGSWYR 455

  Fly   502 SLYS---LLDKYLYTINILPLSRNELCKMVSINYPKLSTVANRIVDVFLTFSSGNH----TSADN 559
            .:.|   :||||...|::..|::.:|.:::...||.|....:.::|:::..:...|    .:.|.
Mouse   456 PMNSHATMLDKYWTKIHLHNLNKKDLNEVLQSKYPSLLAATDHLLDIYIELTGEKHCCPSVAYDK 520

  Fly   560 LRQQESGDKADNTEQYVALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSECAYFVFQ 624
            ..|:.|  :|:...:.|.|            .||.:|.|||:..|:|....|..|||.....:||
Mouse   521 APQEVS--EAERENRRVVL------------EGRELSLRDLLNWCNRVAHGFDPTSSTALLHIFQ 571

  Fly   625 NAVDVFCSYLPQSKEKVTLITSIGAKLGIIRSRCEHFANEYKPDVEFGLEHIKIGRASLLAKSDL 689
            .|:|.|.:.|.:..:|:.:...||::|.|.:.:.|.:...|||::......:::||..||.|.  
Mouse   572 EAMDCFTAMLSEQTKKLRMAEVIGSRLNISKKKAEFYCKLYKPEIVINELDVQVGRVRLLRKQ-- 634

  Fly   690 NNSENEDISEQDLKRQKLSQQTRRAIGKVSNKRTTFSFTRLASCILERIAVCVTHSEPVLLVGET 754
                    ||               :.::..::.||:.||.:|.:||::||||:..|||||||||
Mouse   635 --------SE---------------VVRIQKEKCTFAATRPSSVLLEQLAVCVSQGEPVLLVGET 676

  Fly   755 GVGKTSSVQYLAERTEHKLVVVNMNNQSDVSDLVGGFKPVELNYVLAPLRNEFEYLLCETFNQEK 819
            |.||||:|||||..|...|.|||||.|||.:||:||||||:...:..|||..||.|..:||::::
Mouse   677 GTGKTSAVQYLAYATGQHLRVVNMNQQSDTADLLGGFKPVDHKLIWLPLRETFEELFVQTFSKKQ 741

  Fly   820 NLQFLRLFATHYNSGRHAVIIRTMINICLQVAKNPELKANK------LLPRWQTLREKLQKLQMQ 878
            |..||....|.|...|...:::.|    |.|.|:...|..:      |..:|:....:|...|.|
Mouse   742 NFTFLGHIQTCYRQKRWHDLLKLM----LHVQKSASTKGGEQSQPGLLKEKWEAFGLRLNHAQQQ 802

  Fly   879 LDKSIN-ISFAFIPGSLVNCISNGDWVLLDEINLASAETLECLSTILE-PEGSVVLLERGDFTPV 941
            :..:.| :.|||:.|:|...|..|:|:||||||||:.|||||||.:|| ..||:|||:|||..|:
Mouse   803 MKMTENALLFAFVEGTLAQAIKKGEWILLDEINLAAPETLECLSGLLEGSSGSLVLLDRGDTEPL 867

  Fly   942 KRHPDFRIFACMNPNTDIGKKDLPVGIRNRFTEFFVDELTTDADLSLLVSDYLANTGIQRKSVHN 1006
            .||||||:||||||.||:||::||.||||||||.:|:||.:..||.:|:.|||....:.:.:|..
Mouse   868 VRHPDFRLFACMNPATDVGKRNLPPGIRNRFTELYVEELESKEDLQILIVDYLKGLNVSKNTVQG 932

  Fly  1007 IVQLYKSLRKLSELQLNDGLGNRPVYSLRTLCRSLRICARNLCGSIERNLYESFCLSFLTQLDPN 1071
            ||..|.:|||.|..:|.||.|:||.||||||||:||..|.|.||||:|:|||.|||.||||||..
Mouse   933 IVNFYTALRKESGTKLVDGTGHRPHYSLRTLCRALRFAASNPCGSIQRSLYEGFCLGFLTQLDRA 997

  Fly  1072 SHHVVLLLI-QNALLSNVKAILSKQLPQ-LGENYLDFEGYWIQPGNLEPQPCTHYILTESVKKNL 1134
            ||.||..|| |:.:..|||::|.:.:|: .|...:..|||||..|:.||:....|:||.|||.||
Mouse   998 SHPVVQKLICQHIISGNVKSLLKQPIPEPKGGRLIQVEGYWISVGDKEPKIDETYVLTPSVKLNL 1062

  Fly  1135 KDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLRINNHEHTDLQEYIGTYAADLDGKL 1199
            :|:||::|.|..|:|:||.||.||||||.::|..|||.|:|||||||||:|||||.|.:|..|||
Mouse  1063 RDIARVVSAGTYPVLIQGETSVGKTSLIRWLAAASGNHCVRINNHEHTDIQEYIGCYTSDTSGKL 1127

  Fly  1200 TFREGVLVQAMRHGFWIILDELNLASTDILEALNRVLDDNRELYIAETQTLVKAHPNFMLFATQN 1264
            .|.||||:.|||.|:||:|||||||.||:||||||:|||||||.|.|||.:|:|||.||||||||
Mouse  1128 VFNEGVLIDAMRKGYWIVLDELNLAPTDVLEALNRLLDDNRELLITETQEVVRAHPRFMLFATQN 1192

  Fly  1265 PPGLYGGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTS 1329
            |||||||||.|||||:|||:||||.::|..||||||.|||.:||:|..|:|:.|..||.:|:.:|
Mouse  1193 PPGLYGGRKVLSRAFRNRFVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLDLQSYRRRSS 1257

  Fly  1330 ----KQVF-TLRDLFRWGNRYTHADKSLHDDNRYDWNQHLVEEGYLVLSSKVRSQEEHELIEKTL 1389
                ||.| .|||||||..||..|:::..|   |||.|||..:|:::|:.:||.|||.::|::.|
Mouse  1258 VFAGKQGFIALRDLFRWAERYRLAEQTQED---YDWLQHLANDGFMLLAGRVRKQEEADVIQEVL 1319

  Fly  1390 FANFRKKLDLQTLFDIQTDRE--SSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFD 1452
            ..:|:|||..|:||..:...:  ..|.....:|::  .|   ..:|||.:|.|:||:..:||||.
Mouse  1320 EKHFKKKLCPQSLFSKENVLKLLGKSSTQTTVLES--KF---SHVVWTESMRRLAVLVGRALEFG 1379

  Fly  1453 EPVLLVGPTGCGKTTVCQLLASIADVQLRILNCHMHTEGADFLGGLRPCRGKES------TQLFE 1511
            |||||||.||||||||||:.:::|:.:|..:|||::.|.:||||||||.|.|.:      |:|||
Mouse  1380 EPVLLVGDTGCGKTTVCQMFSALANQKLYSVNCHLNMETSDFLGGLRPVRQKPNDKDELDTRLFE 1444

  Fly  1512 WADGPLIYAMQEGSYFMADEISLAEDSVLERLNCILEPERTVLLAEKGGISELDASPDFVVQAKS 1576
            |.||||:.||:|.|:|:.||||||:||||||||.:||.|:.::|||||.....|...:.:...|.
Mouse  1445 WHDGPLVLAMKEDSFFLLDEISLADDSVLERLNSVLEVEKCLVLAEKGSPESKDNEVELLTAGKH 1509

  Fly  1577 GFQFLATMNPGGDFGKKELSPALRNRFTEVWCLPSDNKEDLIEIAYNCMRRQKEHENQAINTHKV 1641
             |:.|||||||||||||||||||||||||:||..|..:||||:|..:.:|..............|
Mouse  1510 -FRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTKREDLIQIINHNLRPGLSLAGVGHKGAGV 1573

  Fly  1642 AEYLVDVV--LHIRDTNDKFKFSVRDILAWANYMVSNAK-------------LSFAEQAIFGLET 1691
            ||.::..:  |..::...|...|:||||:|.|:|.|.|:             .||...|..    
Mouse  1574 AEVMLAFITWLTRQEFGRKCVVSIRDILSWVNFMNSMAEDAAVKRPEAISTVTSFVHAACL---- 1634

  Fly  1692 IFLDAL-----------EMLPHESQEQVELLKSNIVKQAIKQASLILQEKFTLEELSEKRGTEVE 1745
            :::|.:           .:|..|     |.||. ::|:..|...|..::|..|:.....|..|..
Mouse  1635 VYIDGIGSGVTSSGFGTALLARE-----ECLKF-LIKKLSKVVRLTQRQKDELKIYDRLRHKEFT 1693

  Fly  1746 LNECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLFRLLSALSLQKPVLLEGPPGVGKTSIV 1810
            ..:..:|:.||||............|:...|.||..|..|||.|..|.||:||||.|||||||:|
Mouse  1694 SIDDFWGVHPFFIPRGPVLDGHNTGDYALTAGTTAMNAQRLLRAAKLNKPILLEGSPGVGKTSLV 1758

  Fly  1811 ESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAATERQIRSFVWRDGPLLAALKAK 1875
            .::..|.|..:|||||.|.||:.||||.|||.|..           :...|.|.||||||||||.
Mouse  1759 AALAKASGNTLVRINLSEQTDITDLFGADLPVEGG-----------RGGEFAWCDGPLLAALKAG 1812

  Fly  1876 NTWILLDELNLAPQSVLEGLNAVLDHRGEVYIPELNKSFHLA-GSTRIFACQNPLKQGGGRKGLP 1939
            : |::|||||||.||:||||||..|||||:|:|||..||.:. ..||||.||||.:|||||||||
Mouse  1813 H-WVVLDELNLASQSILEGLNACFDHRGEIYVPELGMSFQVQHEKTRIFGCQNPFRQGGGRKGLP 1876

  Fly  1940 QSFLNRFTKVYLRKLSTEDLLHVVTEKYGKYFDQLNAYFLELLDQKAEGNLFEIYSGKESSCKSD 2004
            :|||||||:|::..|:..|:..:.:..:            ..:|:                    
Mouse  1877 KSFLNRFTQVFVDPLTVVDMEFIASTLF------------PTIDK-------------------- 1909

  Fly  2005 SFDLGARLVRFSEQLDRGV-ASMEFGYKGGPYEFNLRDILRWCDLLHNPQTGYILGASPSSFQAA 2068
              |:..::|.|:..:|..| ...::|.||||:||||||:.|||.|:       ::..||..:...
Mouse  1910 --DIVKKMVAFNNHIDHEVTVEKKWGQKGGPWEFNLRDLFRWCQLI-------LVDQSPGCYDPG 1965

  Fly  2069 FKDFLLTLYERMQLVYYQRMRCDQDKSYIRNVFSTVFLCDA-EYLNQVSNDVALYWTADKVYLND 2132
                     :.:.|||.:|||..:||..:..||..||..:: .|:......:..|    .:.:..
Mouse  1966 ---------QHVFLVYGERMRTREDKEKVVAVFKDVFASNSMPYIGTRQFHITPY----DIQIGY 2017

  Fly  2133 VVLSRKQADVLDLVNRQEQSPL-LLDSQRQQLKQIIETVHMEKPLLLCGSTDSGKTKLIDALCVL 2196
            .||||.     ..|....:.|| ||....|.|:.|::.|.|...::|.|....|||.|:..|..|
Mouse  2018 SVLSRS-----SYVPHPSRRPLSLLHQSFQSLEPIMKCVQMNWMVILVGPASVGKTSLVQLLAHL 2077

  Fly  2197 SNR-----LCNTDIIDDSVTGSFQQIDLNRHLEIIYKKVETLVFSCVQRAFVLHT-QSEFVEQLW 2255
            :..     ..|:.:....:.|.|:|:|:.|...::.:|||..|...::.:.:::: .:|.|.|.|
Mouse  2078 TGHTLKIMAMNSAMDTTELLGGFEQVDIIRPWRLLLEKVERTVRVLLRDSLLINSVDTEVVLQAW 2142

  Fly  2256 NNWSMYNKLAKVTTEAQQHSVLDELKLFSERLGSLGK--IIEVLEATPQNCQVRALQQLAEIKSQ 2318
            :::.:..|                    .:.||..||  .||::.               ::::.
Mouse  2143 SHFLLTYK--------------------PKCLGEDGKGVTIEIVN---------------KLEAV 2172

  Fly  2319 LLLLQ-------TYIKTAD-------------------SLNTGGSFEWVDSQIVTSLKCGQYILL 2357
            |||:|       :|.| ||                   |..:.||||||||.:|.:||.|.::|:
Mouse  2173 LLLMQRLNNKINSYSK-ADFAKLVEDFRSFGVKLLQSASGRSHGSFEWVDSMLVQALKSGDWLLM 2236

  Fly  2358 EHVNLCSSAVLDRLNPVFEPNGSLLIAEKGISAQDSAEVVYKSTNFRAFLTVDPKNGELSRAMRN 2422
            ::||.|:.:||||||.:.||.|.|.|.|:|: ...|...|..:.|||.||::||.:||:||||||
Mouse  2237 DNVNFCNPSVLDRLNALLEPGGVLTINERGM-VDGSTCTVTPNPNFRLFLSMDPIHGEISRAMRN 2300

  Fly  2423 RCVELSLS-RDTYSVD---DLRAFVHEQGVREMEAIDCILRVHKGLSQLTEFN-NYSISHLTQFA 2482
            |.:|:.:| .:..|:.   ||:..:|..|:......:.:|.:|..:..|...: ..|:|.|:..|
Mouse  2301 RGLEIYISGEEDGSIQDNLDLKVLLHSLGLVGDSVCNILLALHTEIQSLVRGSPASSVSTLSHTA 2365

  Fly  2483 FLSAAYRRIGYELKRAIYVAAMEVYVYS----ANTDLMGYGLSYYQNKLREVVLAQTEVFEEVAV 2543
            .|...|.:.|..|.:|.:.|..||||.|    ||..|:                           
Mouse  2366 ILIVQYLQRGLSLHKAFFEACWEVYVCSQHSAANQKLV--------------------------- 2403

  Fly  2544 IQEDFLSDVILNSGNLNSLTLIKRQAVALKVLLDGYTEGKIPQKLLASLFHEMEKLKLDQRNPQK 2608
              :|.|..        ::.:|..|:.....:|..|.....:|..|.|:   |..:|.:.:...|.
Mouse  2404 --QDLLES--------HTASLQARETWGHSILATGLWPDSVPSALFAT---EDSRLSVVRSEGQI 2455

  Fly  2609 LIRHFLYMLYESSAIGDLELRHLYLQPWL-SKDTAFQELSQNLYNC------------------- 2653
            |    .|.|...|         |....|. |:....|:|...:..|                   
Mouse  2456 L----AYCLNRMS---------LKTSSWTRSQPLTLQDLENIMQTCSPDDLTFNAVEVDTCWVDE 2507

  Fly  2654 -----------LQKRSNTDTGTLANLPW---NRKLIPR---------------LRD-YSTAESNS 2688
                       :::.:|.|  .:..:.|   ..|.||:               ||. |||:.|..
Mouse  2508 PEVLATAVKLLIERATNQD--WMLRVKWLCHLAKNIPQGLESVRVHLEASATALRKFYSTSLSAG 2570

  Fly  2689 ELNPL-------------------NLSALLLARLVVDIIPVSSVTTVQQMNALQYSQA------- 2727
            ..|.|                   |:.||.:.|..:|..|.|.  ..:|:.||..|.|       
Mouse  2571 VSNVLKILQTNITDDFVIPLDPRWNMQALDIIRNSLDFDPQSD--QAKQLFALLESVANKTFIYL 2633

  Fly  2728 --------------LCKKQV--------------TEKY---ANHLLANFSSFLEVLHTSLLEDLE 2761
                          :..|::              .|.|   .:.::||.::|.|::...:|..::
Mouse  2634 DREKRIFTEANLVSVGSKKLRSSVLRMSFEFHKDPENYHSPPHEIVANLAAFFELIDGLILLWVQ 2698

  Fly  2762 TADLDLPQYAH---LVTRFHWFNRILATAQQKLLYNNELHVPLMHKLVLHFQWLEKHLLVPLIEL 2823
            :....:|. ||   ::....|.:|....|....:..:.|.:     |.||:.|:.|||:..:.:|
Mouse  2699 SPQGVVPD-AHINKILGSVQWRDRFWTVADTVTVDASGLAL-----LALHWHWVSKHLIYQIPQL 2757

  Fly  2824 TAKSGCARMLTIQ--------------DRTLKIKKYIEETRRPLNVTCKIYSKQFTQFQPYYQDQ 2874
            ...........:|              |....:||......||.....|:....|.|.|...:..
Mouse  2758 LVNQENKYYKELQTVSEHIHSCLGSPADSFAGVKKLQAFLGRPFPFKDKLVVDCFLQLQALNRAL 2822

  Fly  2875 QIQRHIEL-------DDLEKLLSVVPSYGNLELSSWLKRW-LLLQT---DDANKWRSFLRKHTNG 2928
            .|...:.:       :|:.: |.||.|..||: .|.|:.| |:|:.   :|.|     |.:..|.
Mouse  2823 AIGEQLPVFGECGWQEDINR-LQVVASEWNLK-KSLLQAWGLILRANILEDVN-----LDELKNL 2880

  Fly  2929 FQPKAFEISGSLRNETLQSHLQKLQTTLKEAQENSAEIEMDLELDLNSIKTLLEAETEESESYIH 2993
            ...:..|    |::..|.      :..|::|.:.|:..:.||                  .|.:|
Mouse  2881 VSTQCSE----LKSRGLS------RGFLEKAHDASSPSQPDL------------------SSLVH 2917

  Fly  2994 PDGIPTNTPKLLIAA--LRELFMER----------LLTGTLRDDFDEQVN----------PLYAD 3036
                .|...:|..||  |..|:..|          |...:..|..||:::          |:...
Mouse  2918 ----LTRRVQLWPAAEYLAMLWQYRVTADFIAQACLRRSSKHDQMDEEISHHIAFCLKHTPIAPQ 2978

  Fly  3037 QLLTLNSNLWHCLKTLESANRTEITNAWIELKNEVNELQNYDEFAVLLEKIGGGYKGLRSYQRQY 3101
            :|.    |||..|. :|..:..|::..|.||               .....|.      |:....
Mouse  2979 KLW----NLWSLLH-IEMLSAQEVSCLWSEL---------------FTSTFGS------SWSSPV 3017

  Fly  3102 RNSVQCY----------QLENLSTRLD-CVQGPSEEGS--TDISSQFCYRGPALSGVI------- 3146
            ..:.:|:          |.|...:|.| .::||   ||  ..:.|:.|:      ||:       
Mouse  3018 TTAPECWLAWSPLPNIQQQEVPRSRWDSTLKGP---GSLCRAVFSKCCF------GVLTNSSRAS 3073

  Fly  3147 ------LSLICQPNGQLRSVPLSELLEWRSALQQTRHLIWEN----------------SQLLTSR 3189
                  |.|:...:     |.|.|.:|....||....|:|.|                ..|:..|
Mouse  3074 YWDVSGLPLLSSSH-----VTLGEWVERAQQLQDISSLLWTNMAVPSVAEFRRTDSRLQGLVLCR 3133

  Fly  3190 YSGEVNNLLQA------KENARQLLKELEYVRKLSEKEQKANQ--GFENCAKELEKMI------- 3239
            |...:..||.|      .:|...||  |...:.....:|....  |.|...|||..::       
Mouse  3134 YLLGLTELLPAHQRQEYMQNCEHLL--LGNTQAFHHVDQTMGNIGGQEALPKELLCLLLTSLHYF 3196

  Fly  3240 --EKLEKEENNNASMTKDFEVSLTNALVGAIELCLLTNTPLIDPVEKNRLKNEYIAEDI------ 3296
              |...|:....|:......|||     |.:::.........||..|...|..|..:::      
Mouse  3197 IGEGEGKQNLPEAARRGRLWVSL-----GLLQIQTWLPRARFDPAVKKAYKLRYAQDELRQLQCE 3256

  Fly  3297 ----DCLSTLTTAYDFMKIAMKYRHFGEEIYSELELRLRTALQRQQQ-------LSQKLALRSEK 3350
                :.||.|.|..|..         .:.|.|.....::...||..|       ||:|.|.|...
Mouse  3257 LKTRNLLSHLQTGRDLE---------DDIITSHSHPHIKLLPQRISQLESLVHSLSKKQAFRPHL 3312

  Fly  3351 CLYASLVQDITHFLHSNGDC----ESLYKLFQLIHSEWENFQGLHVATSAQLKSSIEVLGKLDLW 3411
            ..|.:|||:|.|::.|....    :.|.:|.|.:|::...        |||:..::  |.:...|
Mouse  3313 PSYETLVQEIHHYVTSIAKVTAVQDLLMRLLQALHTDGPK--------SAQVLQNL--LKEEASW 3367

  Fly  3412 LANAQRFVHHTLSRYSAYYQDFVEPIKCSVNQLRFGLESLKVIFTRVQQA--GSVSQAEQMQQTI 3474
            ..:..:|....:..| |.|.|.|.|:..|:.||:.|   ::::.:.|..:  ..|..||.:....
Mouse  3368 QQSHHQFRKRLVEEY-ALYPDTVAPLLASILQLQHG---MRLVASEVHASLHSGVLCAENLGALA 3428

  Fly  3475 GDIVQFPSQHP---------------------------LVIRNSRLYGLLAELPHSEYEY---FR 3509
            ..::.|||..|                           :|.|.:|     .|...|:..|   .:
Mouse  3429 MAVLAFPSVGPSFPTYHAHADALCSVNAAEALRSLGKLMVKRAAR-----KEEAKSQQAYPTREQ 3488

  Fly  3510 LLKAKLSELSNYIALGRVIDETTFAAYDDALSICNQTWQQEEHRRCQLKAEAE-SLYVTKTKGG- 3572
            ||...|..|.:::.....:|:.....:..........|.::| |..|.|||.| |||..:::.| 
Mouse  3489 LLMNALLYLRSHVLCKGELDQRALLLFRHLCQEIINEWDEQE-RIAQEKAEQESSLYRYRSRSGR 3552

  Fly  3573 -VDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASAKDKQSQIVVEEDYAFLARN 3636
             ..|||..|..|:...||.: ::|||:.:.:||||:      |....|.:.:....:.......:
Mouse  3553 TALSEEEEEELELRKLFPLH-EKDFADILMEPTLEE------KKKVSDGREEEAAPDPTLLCQSS 3610

  Fly  3637 FIDVMTRHTQ--------VYYKE--QPKSSKELELHLLAPYQARFQVFANLHGHYKTALGSSLEE 3691
            ...||..|.|        ::|::  .|..:|    |.|:.:.:.:|..|:|..|:...:|..|.:
Mouse  3611 MQAVMLIHQQLCLSFARSLWYQQAVPPHEAK----HYLSLFLSCYQTGASLVTHFYPLMGVELND 3671

  Fly  3692 RACNGLAFGLALQQKQL-----RDIELEEGVSSSPYDFYKDSNISEIQSCLDVMERIEKRVLEQL 3751
            :..........|....|     .|:.:.   ...|||||:..|::|.:.|..|::...:.|.:.|
Mouse  3672 QLLGSQLLACTLSSNTLCGEATSDLMMR---PDGPYDFYQHPNVAEARQCQPVLQGFSEAVSQLL 3733

  Fly  3752 EQYPEHAGLADIKLVISRIRRLPAHAPVVRFNTGFQLLRQKLALWNEVAHRNNNLVSEEIEVAEF 3816
            :.:|||..|..:.:|:.|||..|..:|:.:|..|.::|..|...|.|.|.|..:|......|::.
Mouse  3734 QDWPEHPVLQQLLVVMDRIRGFPLSSPISKFLNGLEILLAKAQDWEENASRVLSLRKHLDLVSQM 3798

  Fly  3817 VQRWTRLELQHWRNCLGQTAAQVELQAYRYWFFIYNLLQQFIHQKQLDHSYTDIKLAEQRFAQDH 3881
            :.||.:|||..|...|..|..:...::.::||.||.:|::.:.::                    
Mouse  3799 IIRWRKLELNCWSMSLDNTMIRHTEKSTKHWFSIYQMLEKHMQER-------------------- 3843

  Fly  3882 LLDAQDLGESQRLELAQVVRILRQFVEASCYGDFHIRLQLLQGFELYLHNVERAGKINGLPPLIA 3946
               .::..:.:::.|..:|..|:.|:|.|..|:||:|||:|..|..:   |....::.|...|.:
Mouse  3844 ---TEEQEDDKQMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHCH---VLLMPQVEGKDSLCS 3902

  Fly  3947 ALHNLQLYFSQFAGEIADSAKLRRSPIEKKLKEFVKIQSYSKDLSYFSMRNSVASVHRNLNKFLK 4011
            .|.||..::.||...:.......||||||:|||||||..:: |:|::|::.||...||.|.||:|
Mouse  3903 VLWNLYHFYKQFLDPVKAKIMELRSPIEKELKEFVKISKWN-DVSFWSIKQSVEKTHRTLFKFMK 3966

  Fly  4012 EYRLSIQEKISEVFQPKD---------STAKDYTFGTDKGKGLRNYNKIKYLHTERQQFVASEKL 4067
            ::...:.|.........|         ...::.|..|...:||.|                    
Mouse  3967 KFEAVLSEPCQSCLVESDKEEQPDCLPKPTEEATMETSPIQGLNN-------------------- 4011

  Fly  4068 LEKFAIQEEFLS---------------------DNTLLQRLDKHFRTARHVVKETLGQVPYGELI 4111
                |::|..|:                     :..||:||.:..:..|.:....:.:.|...|:
Mouse  4012 ----ALRETLLAQPVEWKPSGTEQCQDASPLSVEGELLRRLPRLSKRMRKMCLVFMKESPLPHLV 4072

  Fly  4112 TELDDLLASQLERCEHLRSLNVDRSKERPQQKQEAKQILQQKRKALTDLFKMLHRLGANYKTGLL 4176
            ..||......:.....|:||.||.|.|:.:|..|||.||.||.:||:||||.|..:|.:|:.||.
Mouse  4073 ESLDQFTGGVISSVSELQSLKVDPSAEKEKQHSEAKHILLQKHRALSDLFKHLANIGLSYRKGLA 4137

  Fly  4177 ELSLRNEFEDFQLPPYSIRSMLPRLHPTAQQLDEHL-----------DLYYMKSVFKLKLLQNIM 4230
            ....::..|...|.|..:||.|..:..| ::.|..|           ..|:.:|:.:...|...:
Mouse  4138 WARSKSPQELLHLHPLDLRSALSIVSST-READSRLLTEISSLWDGCQKYFYRSLARHTRLTAAL 4201

  Fly  4231 LTPLSELGPPNIERIKGFAVDLFLLVQQQREHLSGSTKELHELRNSLDSLRKLAEIIPQADINPS 4295
            .||:.|:....|||.|||:..|..|:.:||..|:..|::...|||.|..::::...:....:.|.
Mouse  4202 ATPVKEVSMGTIERCKGFSAHLMKLLIRQRHSLTTLTEQWIILRNLLSCVQEIHSRLTGPPVYPV 4266

  Fly  4296 TLNFVKSADIAMEIKQHL-RQIHYVLKQWKLLLSCAPS------------------SFIEESENR 4341
            ......|.....|..||| .|...:|:|:..|..|.||                  |.:|..:.:
Mouse  4267 AFPPQDSVQQWTERLQHLAMQSQILLEQFSWLFQCCPSAEPTVGHRDAQVQEHPSASHLENIDFK 4331

  Fly  4342 ---------LLVRKIS----LAQSELHSLC-----IQILNSSQELLNEL------NNANLEYLSS 4382
                     ||...:|    :..|:|.|.|     .|:...|...|.|:      ..|.::.:..
Mouse  4332 ETIAGVMPDLLSSDLSYPSPVPTSQLPSACRMRRQDQLWQQSTAGLTEMLKTIKTMKAGVDKIRQ 4396

  Fly  4383 EKCVTYQKSY-------------AEIQENIKKTLEL-----LRTGQNDYLPLAQPIVELLDSVQL 4429
            :.|.|...::             :::..:::....|     :...|.|   ....:||.||.:: 
Mouse  4397 QSCETLFHTWEDFEVCSSGLNCLSQVSAHLQGLASLFILPGIEVEQTD---SRMALVESLDYLR- 4457

  Fly  4430 KNHTEIAPEAIDLANADTELANIAH-------------------------SVLMSMQKIYKHHVK 4469
               .|:: :|||...|......:||                         ::|.::|.:.:.:.|
Mouse  4458 ---GEVS-KAIDDFTAWKARLFVAHKQEGNQMVEESFVEDFSEQVETAIRAILCTIQNLAERNNK 4518

  Fly  4470 ------TDEVNQNGEAKEQDEESKEALQEQHLKKCLTGELTSDWQQLSLPRVLGKLSNVLLVLKH 4528
                  .|:..|..:..:::|.|.::||..||.|.|..:..:....|.:.:::..:|.:|..||.
Mouse  4519 KAEDSAVDKRLQEEDGGKEEEASFKSLQPGHLTKLLEDDFWASVSTLHVQKIISSVSELLERLKS 4583

  Fly  4529 SHFEG---KDKL------LCVRRAIGLLPVLEQYQLLADYLLLQQLATHKVSAKMLSIVLTVFVE 4584
            ...:|   |.|:      |.||    |:|:|..:..|..:.|...||||:.:||:||::...|.|
Mouse  4584 CSEDGNTTKHKVFSQSCGLLVR----LIPILCGFSDLVLFFLTVSLATHRSTAKLLSVLAQTFTE 4644

  Fly  4585 IGSKGFCVPPDLMQDEEGQSKQESKNGEGFGLEDGTGENDASDKIESEDQLDDAKRPEDRKDEGD 4649
            :..||||:|.:||:|..|:...:..:.||.|:.||.|..|.||:||:|:|::|..:....|||.|
Mouse  4645 LSQKGFCLPKELMEDSAGEGATQFHDYEGGGIGDGEGMKDVSDRIENEEQVEDTFQKGQEKDEED 4709

  Fly  4650 -KQEPDCK-EEKGIEMSDDFDAKMQDVE-KPEEDDSGESEEEEDLNKEMGETE-EGAEKLDDQIW 4710
             ..:||.| |:..||||:|||.||.|.| :.||||.....|:.||:|:||... |.|:|||:::|
Mouse  4710 LDSKPDTKGEDNAIEMSEDFDGKMHDGELEQEEDDEKSDSEDGDLDKQMGNLNGEEADKLDERLW 4774

  Fly  4711 GDDEEEKPE-----EEQEPDMNEEDQGKGSKDEK-DAHN-DLDTKNDAAKEDGKDEHEKDGLDAT 4768
            ||||||..:     ||..|.::|||....:||:. ||.| :.:.|:...|||.:.|..:.|.:..
Mouse  4775 GDDEEEDEDGDGRAEETGPGVDEEDSELVAKDDSLDAGNLNKNKKHQDEKEDSEPEDVEQGQEKI 4839

  Fly  4769 NEPSGEDKRKEQAKDIDDMKDPEMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDE-----GHDDQ 4828
            ||            .||:.   |.||.:.:..|...|:.||||.:||.|...:|.     |.|..
Mouse  4840 NE------------QIDER---EYDENEVDPYHGNQEKLPEPEALDLPDDLKLDSEDKSGGEDTD 4889

  Fly  4829 DEQPTDENPFDIDA----MKENMQPAEEPEA---DGDDEHDANEEGDPQSD--------GSDSEE 4878
            :|:..:|||.:|..    |:|.....|||.|   :|:..|:. ||| |..|        |:|.::
Mouse  4890 NEEAEEENPLEIKEKTVDMEETDHEIEEPGAGQDEGESPHEP-EEG-PSEDKENMDMDTGADDQD 4952

  Fly  4879 DEAGTEAKPAEEDHGEGEEATPEDEKDEAETQK-RGELEDEDDSKPEDSP-EDSKEEKEEKREEK 4941
            .:..:.|    |:|...|||..|:||.|.|..| ..:...|....|.|.. :..|||:||..:..
Mouse  4953 RDTSSHA----EEHSLEEEAEEEEEKGEKEEDKATTDGGGESGVNPVDQGLQPQKEEEEEGEQSD 5013

  Fly  4942 PEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAE-ND 5005
            .||  |..:...::|:.     |...:..|.||..|..::.  ....|:|.|:|:.|.|.|: |.
Mouse  5014 AEE--QVPEATERKEHA-----TCGQTGVDNVQSAQAVELA--GAAPEKEQGKEEHGSGAADANQ 5069

  Fly  5006 ADDGGHQGVAETQETVSQEDRKNERQTQE-KRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKE 5069
            |:  ||:.....:.:..|...||   ||. ||:.|:.:.|||:|:..:...|:|:|:.       
Mouse  5070 AE--GHESNLIARLSSQQHTNKN---TQSFKRRPGQADNERSVGDYNERVRKRLRTVG------- 5122

  Fly  5070 SDDAEQEKPEPMDQTEAEEYQHVKEPKNS-DKTTLDNATEEQSK--KIQHQEDEPPNEEEIEAEN 5131
            :|...:::|......:|:.::|||:..:: |..|.|.|:.||.:  |...|:.|   |||||   
Mouse  5123 TDRETEQEPTQAQVEDADAFEHVKQGSDAYDAQTYDVASSEQQQTAKASGQDQE---EEEIE--- 5181

  Fly  5132 VDELMEAEEPAVDPEDDAELEQLGAEKTEQKSDKPS------------KTEKSKEQLETPEGMEI 5184
             |.||:.||..:..||   .|||..|..:.::...|            ||::.::...|....|.
Mouse  5182 -DILMDTEEELMRAED---TEQLKPEAVQSETAATSGSSEMEVDMQTLKTKEDQDPRTTTPHQET 5242

  Fly  5185 EGEVVLTMTVPRSSETTAHSNSEILLDK--SSHAEDLSSAEQIELRQQYQKQLTTFRV-----AQ 5242
            |.|     ...||.::|.|:..:.|:|.  ....:|:|     ||||:.::||.|::.     |:
Mouse  5243 ENE-----RPERSRDSTIHTLRQFLVDSVFQPILKDIS-----ELRQEMERQLETWQAHDYGNAE 5297

  Fly  5243 PEHEDYETWQGISNRMTQNARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKD 5307
            .|....|.||.........:::|||||||:||||:..:|:||||||:|:||:|||||||||||||
Mouse  5298 EEKAAAEMWQNYLVLTASLSQQLCEQLRLLLEPTQAAKLRGDYRTGKRLNMRKIIPYIASQFRKD 5362

  Fly  5308 KIWLRRTKPAQRDYKITIAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQI 5372
            :||||||||::|.|:|.:|||||.||..|::|.|..|:::::..||||||.|::::.||||:.::
Mouse  5363 RIWLRRTKPSKRQYQICLAIDDSSSMVDNHTKQLAFESLAVIGNALTLLEVGQIAVCSFGESVKL 5427

  Fly  5373 ILNHTEQFD---GPRLVNALNFAQDKTKIAGLLNFIRT--ANAEESGTGGDNGLFEN-------L 5425
            :....|||:   |..::....|.|.|||||..|..:..  |.|::        |.:|       |
Mouse  5428 LHPFHEQFNDSSGTHILRLCTFQQRKTKIAQFLETVAKMFAAAQK--------LSQNVSPETAQL 5484

  Fly  5426 LLILSDGRNIFSEGAQNVKNAIKLARLQRIFLVYIIIDNPDNKNSILDIQHVAVNADGSV-NINS 5489
            |||:||||.:|.||...|..|::.|:...||::::::|||::::|||||:.......|.: .|.|
Mouse  5485 LLIVSDGRGLFLEGKDRVLAAVQAAQNANIFVIFVVLDNPNSRDSILDIKVPIFKGPGEMPEIRS 5549

  Fly  5490 YLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELVNS 5525
            |::.||||:|:|:||:|.||..||:|:|||||||.:
Mouse  5550 YMEEFPFPFYIILRDVNALPETLSDALRQWFELVTA 5585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 1845/5825 (32%)
P-loop_NTPase 315..505 CDD:304359 76/190 (40%)
P-loop_NTPase <887..972 CDD:304359 57/86 (66%)
P-loop_NTPase 1147..1283 CDD:304359 101/136 (74%)
P-loop_NTPase 1454..1603 CDD:304359 93/155 (60%)
P-loop_NTPase 1795..1946 CDD:304359 92/152 (61%)
P-loop_NTPase <2335..>2378 CDD:304359 24/43 (56%)
Prothymosin 4843..4920 CDD:281265 28/89 (31%)
PHA03151 4856..5060 CDD:177546 63/216 (29%)
MttA_Hcf106 <5046..5166 CDD:294511 36/123 (29%)
vWA_midasin 5261..5526 CDD:238737 132/279 (47%)
Mdn1XP_006537539.1 P-loop_NTPase 325..453 CDD:304359 76/183 (42%)
P-loop_NTPase 649..>682 CDD:304359 22/33 (67%)
P-loop_NTPase 669..898 CDD:304359 118/233 (51%)
AAA 1075..1217 CDD:214640 106/142 (75%)
P-loop_NTPase 1075..1211 CDD:304359 101/136 (74%)
P-loop_NTPase 1363..>1397 CDD:304359 24/34 (71%)
AAA 1379..1535 CDD:214640 94/157 (60%)
AAA_5 1381..1535 CDD:285029 93/155 (60%)
P-loop_NTPase 1743..1883 CDD:304359 92/152 (61%)
P-loop_NTPase 2057..>2110 CDD:304359 14/53 (26%)
P-loop_NTPase <2215..2301 CDD:304359 46/87 (53%)
ASF1_hist_chap <4684..4827 CDD:304562 64/143 (45%)
vWA_midasin 5316..5586 CDD:238737 132/279 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354819304
eggNOG 1 0.900 E1_COG5271
Hieranoid 1 1.000
Homologene 1 1.000 H39689
Inparanoid 1 1.050 2387 1.000 Inparanoid score I34
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003656
OrthoInspector 1 1.000 T1082360
orthoMCL 1 0.900 OOG5_127263
Panther 1 1.100 LDO PTHR22908
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R702
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.