DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and EMB2757

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_194715.2 Gene:EMB2757 AraportID:AT4G29860 Length:386 Species:Arabidopsis thaliana

Alignment Length:395 Identity:105/396 (27%)
Similarity:170/396 (43%) Gaps:97/396 (24%)


  Fly     5 PPDPVFSLRSPDMGAVNSLCFQESDRLL-AGTIKGSVFLWDLQTNR--SALHFEVGSDPITSLHH 66
            |||||..||. ...:|..:.|..|..|| .|:..|.:.:||...:|  |:......::.:.::..
plant     6 PPDPVAVLRG-HRHSVMDVSFHPSKSLLFTGSADGELRIWDTIQHRAVSSAWAHSRANGVLAVAA 69

  Fly    67 TP----DRLVTQEKGGTITMFSI--GGSSYVKERSIPGNHLGFCRSAL-----------HTNTSK 114
            :|    |::::|.:.||:..:.|  ||.|......:......||:.:|           .:::..
plant    70 SPWLGEDKIISQGRDGTVKCWDIEDGGLSRDPLLILETCAYHFCKFSLVKKPKNSLQEAESHSRG 134

  Fly   115 TNEQLLFYPC-----------EESSIGVLHVTDAA-----------APTQILV------------ 145
            .:||.....|           ||.| |:|...|.|           .||::.:            
plant   135 CDEQDGGDTCNVQIADDSERSEEDS-GLLQDKDHAEGTTFVAVVGEQPTEVEIWDLNTGDKIIQL 198

  Fly   146 ----PDD-PQLPKLGSVTC-----FKPFECASQLFLLAGYESGHFLTWDISSSVILDVMELAQDA 200
                ||: |.....|...|     |.|.|....|.:|||||.|..|.|||.::.|        ..
plant   199 PQSSPDESPNASTKGRGMCMAVQLFCPPESQGFLHVLAGYEDGSILLWDIRNAKI--------PL 255

  Fly   201 TSVDY--DPV--------TNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIKNPGVNGVRIRPDQ 255
            |||.:  :||        .:.||.||..||::.::...|:....:..|:.::.|||:|..||.|.
plant   256 TSVKFHSEPVLSLSVASSCDGGISGGADDKIVMYNLNHSTGSCTIRKEITLERPGVSGTSIRVDG 320

  Fly   256 KVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVAMWHAP---IMAAAGMDGQIS 317
            |:.|:||||.|||:::::....||:|..|:          :...|:.::|   :||:|..|..::
plant   321 KIAATAGWDHRIRVYNYRKGNALAILKYHR----------ATCNAVSYSPDCELMASASEDATVA 375

  Fly   318 LWDLY 322
            ||.||
plant   376 LWKLY 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 103/393 (26%)
WD40 repeat 62..98 CDD:293791 9/42 (21%)
WD40 repeat 103..147 CDD:293791 16/93 (17%)
WD40 repeat 200..245 CDD:293791 14/55 (25%)
WD40 201..>321 CDD:295369 41/133 (31%)
WD40 repeat 247..282 CDD:293791 16/35 (46%)
EMB2757NP_194715.2 WD40 9..378 CDD:295369 100/389 (26%)
WD40 13..379 CDD:225201 98/386 (25%)
WD40 repeat 21..59 CDD:293791 10/38 (26%)
WD40 repeat 64..129 CDD:293791 12/65 (18%)
WD40 repeat 216..260 CDD:293791 19/52 (37%)
WD40 repeat 265..307 CDD:293791 9/42 (21%)
WD40 repeat 314..347 CDD:293791 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41515
Inparanoid 1 1.050 96 1.000 Inparanoid score I2155
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1543596at2759
OrthoInspector 1 1.000 T193291
orthoMCL 1 0.900 OOG5_131248
Panther 1 1.100 LDO PTHR19854
Phylome 1 0.910 0.667 Consistency score
87.970

Return to query results.
Submit another query.