DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and GNB1L

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_443730.1 Gene:GNB1L HGNCID:4397 Length:327 Species:Homo sapiens

Alignment Length:353 Identity:110/354 (31%)
Similarity:167/354 (47%) Gaps:72/354 (20%)


  Fly     5 PPDPVFSLR---SPDMGAVNSLCFQESDR------LLAGTIKGSVFLWDLQTNRSALHFE-VGSD 59
            ||||.|.||   ||    |::|.|.|..:      |.:|:..|.|.:|.|||.|:....: .|..
Human     9 PPDPQFVLRGTQSP----VHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQ 69

  Fly    60 PITSLHHTPD--RLVTQEKGGTITMFSIG-GSSYVKERSIPGNHLGFCRSALHT----------- 110
            .:|.|...|.  :|::|.:...:.::.:. |.|.|.: |:....:|||||::..           
Human    70 CVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVD-SVCLESVGFCRSSILAGGQPRWTLAVP 133

  Fly   111 NTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKPF--ECASQLFLLA 173
            .......|:|..|.:.|...:....||               |||...|.:.:  :|:|:..|||
Human   134 GRGSDEVQILEMPSKTSVCALKPKADA---------------KLGMPMCLRLWQADCSSRPLLLA 183

  Fly   174 GYESGHFLTWDISSSVILD--------VMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQ-RS 229
            |||.|..:.||:|...:..        ||:|       |:|....|||.|.....|..:|.. :.
Human   184 GYEDGSVVLWDVSEQKVCSRIACHEEPVMDL-------DFDSQKARGISGSAGKALAVWSLDWQQ 241

  Fly   230 SMQMQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAF 294
            ::|::...||  .|||:..|.||||:|:.|:||||.|||:|.|::::|||||..| :..|..:||
Human   242 ALQVRGTHEL--TNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFH-SAAVQCVAF 303

  Fly   295 SSQQVAMWHAPIMAAAGMDGQISLWDLY 322
            ::.       .::||...|.:||||.||
Human   304 TAD-------GLLAAGSKDQRISLWSLY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 108/351 (31%)
WD40 repeat 62..98 CDD:293791 9/39 (23%)
WD40 repeat 103..147 CDD:293791 10/55 (18%)
WD40 repeat 200..245 CDD:293791 13/46 (28%)
WD40 201..>321 CDD:295369 46/121 (38%)
WD40 repeat 247..282 CDD:293791 21/35 (60%)
GNB1LNP_443730.1 WD40 14..322 CDD:330360 104/345 (30%)
WD 1 16..54 13/42 (31%)
WD 2 58..97 7/39 (18%)
WD40 repeat 70..110 CDD:293791 9/41 (22%)
WD 3 103..145 9/43 (21%)
WD40 repeat 115..155 CDD:293791 8/40 (20%)
WD 4 153..195 17/57 (30%)
WD40 repeat 164..205 CDD:293791 13/41 (32%)
WD 5 200..237 11/44 (25%)
WD40 repeat 211..248 CDD:293791 12/44 (27%)
WD 6 242..282 21/42 (50%)
WD40 repeat 255..296 CDD:293791 23/42 (55%)
WD 7 286..323 16/45 (36%)
WD40 repeat 298..321 CDD:293791 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0322
Hieranoid 1 1.000
Homologene 1 1.000 H41515
Inparanoid 1 1.050 128 1.000 Inparanoid score I4603
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1543596at2759
OrthoFinder 1 1.000 FOG0004983
OrthoInspector 1 1.000 T1072804
orthoMCL 1 0.900 OOG5_131248
Panther 1 1.100 LDO PTHR19854
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R93
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.