DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and gnb1l

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001013526.1 Gene:gnb1l ZFINID:ZDB-GENE-050320-77 Length:323 Species:Danio rerio

Alignment Length:338 Identity:110/339 (32%)
Similarity:175/339 (52%) Gaps:32/339 (9%)


  Fly     1 MAVLPPDPVFSLRSPDMGAVNSL---CFQESDRLL-AGTIKGSVFLWDLQTNRS--ALHFEVGSD 59
            ||..||||::.||... .:||:|   |..:...|| :|:.||:|.:|:|.|.|:  .|....|:.
Zfish     1 MARPPPDPLYILRGSG-ASVNALHFCCDGDGPPLLYSGSGKGAVHVWNLSTRRAERVLESHAGNS 64

  Fly    60 PI--TSLHHTPDRLVTQEKGGTITMFSIG-GSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLF 121
            .|  .:.:::...|::|.:...:.::.:. |.|.|.: |:....:|||:.:|  ..|:....||.
Zfish    65 VIWLNTFNNSRSCLISQGRDMRVCVWDLSEGRSAVTD-SLHTGSVGFCQCSL--LGSRLGSTLLA 126

  Fly   122 YP---CEESSIGVLHVTDAAAPTQI--LVPDDPQLPKLGSVTCFKPFECASQLFLLAGYESGHFL 181
            :|   .||.|     |.:.::.||:  |.||.    .||.:...|.::..|...|.||||.|..:
Zfish   127 HPTQHMEEVS-----VVEMSSWTQVCSLKPDS----NLGMLMSMKMWQADSGPVLCAGYEDGSVV 182

  Fly   182 TWDISSSVILDVMEL-AQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIKNPG 245
            .||:|......:::: .:...|:|.|....:||.|...:.|.|:... :...:|:...:.:.|||
Zfish   183 LWDVSHRRPFSLLKVHPEPVMSLDVDVCRQKGISGSSENILQSWRLD-NQQSLQMHDSIQMTNPG 246

  Fly   246 VNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVAMWHAPIMAAA 310
            |:.:|||.|.|:.||||||..||:|.||.|:||||| ||....|..:|||..|.....  ::||.
Zfish   247 VSQLRIRADGKILASAGWDNNIRVFGWKKLKPLAVL-QHHTDMVNSVAFSDHQDPTQR--LLAAG 308

  Fly   311 GMDGQISLWDLYN 323
            ..|.:||:|.:|:
Zfish   309 SKDQRISVWSIYS 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 107/331 (32%)
WD40 repeat 62..98 CDD:293791 6/37 (16%)
WD40 repeat 103..147 CDD:293791 15/49 (31%)
WD40 repeat 200..245 CDD:293791 11/45 (24%)
WD40 201..>321 CDD:295369 48/120 (40%)
WD40 repeat 247..282 CDD:293791 22/35 (63%)
gnb1lNP_001013526.1 WD40 <8..322 CDD:225201 105/332 (32%)
WD40 12..323 CDD:295369 104/328 (32%)
WD40 repeat 20..58 CDD:293791 14/38 (37%)
WD40 repeat 62..129 CDD:293791 16/70 (23%)
WD40 repeat 136..199 CDD:293791 20/72 (28%)
WD40 repeat 205..235 CDD:293791 7/31 (23%)
WD40 repeat 247..283 CDD:293791 23/37 (62%)
WD40 repeat 289..317 CDD:293791 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0322
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41515
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1543596at2759
OrthoFinder 1 1.000 FOG0004983
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131248
Panther 1 1.100 LDO PTHR19854
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.