DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and C10B5.1

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_505213.2 Gene:C10B5.1 WormBaseID:WBGene00015670 Length:311 Species:Caenorhabditis elegans

Alignment Length:365 Identity:78/366 (21%)
Similarity:121/366 (33%) Gaps:102/366 (28%)


  Fly     3 VLPPDPVFSLRSPDMGAVNSLCFQESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHT 67
            :.||.|:|:....:.||..| |. .:.:||.|:..|.|..:.|::..        .:.|..:...
 Worm     2 IKPPSPIFTFFGIEGGATCS-CL-NNGQLLVGSQNGMVQAFGLESKI--------MEHIVYVDEE 56

  Fly    68 PDRLVTQEKGGTITMFSI-------------GGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQL 119
            ..|:.:.|..|..|...|             ..|::...|:|..:|:|||      |......||
 Worm    57 ERRIQSIEISGNDTFVYIRSYAVLQLRKPEMSKSTWKVIRTIEVDHVGFC------NFLILQSQL 115

  Fly   120 LFYPCEESSIGVL---HVTDAAAPT---QILVPDD--PQLPKLGSVTCFKPFECASQLFLLAGYE 176
            ||...::.....|   .:.|.:.||   :||...|  |....:|.         ..:..:|.|.|
 Worm   116 LFASTDDKRYAKLCWTEIKDESIPTKSNRILDEADVNPMCMLVGE---------EKENEVLIGME 171

  Fly   177 SGHFLTWDISSSVILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCI 241
            .|........:.     |...|....:..||:               |....||..:..|   |.
 Worm   172 DGRLAICYGDNG-----MFECQAKQKLGRDPI---------------FCIASSSKWVAAG---CA 213

  Fly   242 KNP---------------------GVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHK 285
            :.|                     |.:.:...|:.|...:..|||.||:||...|..|..||...
 Worm   214 RAPIYLLNRYDLSKQEIPYPPDAAGCSAISFSPNSKQIIAGFWDGSIRVFSRHRLNVLLALTNAH 278

  Fly   286 NGGVMDLAFSSQQVAMWHAP----IMAAAGMDGQISLWDL 321
            :..:..:        :|..|    |:.|...|..:|||.|
 Worm   279 SSTISSI--------IWLPPEQGEIVIATSSDSTVSLWKL 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 77/362 (21%)
WD40 repeat 62..98 CDD:293791 8/49 (16%)
WD40 repeat 103..147 CDD:293791 13/50 (26%)
WD40 repeat 200..245 CDD:293791 8/66 (12%)
WD40 201..>321 CDD:295369 30/145 (21%)
WD40 repeat 247..282 CDD:293791 12/35 (34%)
C10B5.1NP_505213.2 WD40 53..>311 CDD:225201 63/305 (21%)
WD40 repeat 106..141 CDD:293791 10/41 (24%)
WD40 237..>311 CDD:295369 23/83 (28%)
WD40 repeat 239..275 CDD:293791 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004983
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR19854
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R93
TreeFam 1 0.960
66.000

Return to query results.
Submit another query.