DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and asa1

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_594849.1 Gene:asa1 PomBaseID:SPAC1006.02 Length:368 Species:Schizosaccharomyces pombe

Alignment Length:381 Identity:103/382 (27%)
Similarity:149/382 (39%) Gaps:80/382 (21%)


  Fly     6 PDPVFSLRSPDMGAVNSLCFQESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSL------ 64
            |.|.:.||. ...:|.|:.|..::.|.:|...|.|..|.|.:.|....:...:..|..:      
pombe     4 PTPFYVLRG-HSSSVTSVLFDANEYLYSGDEAGFVICWCLTSMRPKCAWRAHTKTILGMQIVKGG 67

  Fly    65 ----HHTPDRLVT---------------------QEKGGTITMFSIGGSSYVKERS-IPGNHLGF 103
                |....||||                     |..|...:..:...|:::...| |..|.|.|
pombe    68 ALCTHGRDCRLVTWKIDFNCMTDNFMSLSKLAELQNYGPEASSETEKSSAFISIHSNIVVNSLTF 132

  Fly   104 C------RSALHTNTSKTN-EQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFK 161
            |      :|.:....:..| |:|..|..|.......|..|.....|..:..:..:.|.|||....
pombe   133 CPFSYSPQSKIVVLCNTLNFEELDVYDDESLYHPQTHKEDCGKRLQTRIQPEESVGKTGSVMSTS 197

  Fly   162 PFECASQLFLL-AGYESGHFLTWDIS----SSVILDVMEL----------AQDATSVDYDPVTNR 211
            ......:..|| |||||||.:.:..|    .:|.||...:          :|...||:|   ...
pombe   198 VTVTDEKYVLLAAGYESGHVVQYICSLENVKTVTLDFKAVWKMVYAYKSHSQPVLSVEY---AGS 259

  Fly   212 GIVGGPTDKLISFSYQRSSMQMQLGSELCIKNP--------GVNGVRIRPDQKVFASAGWDGRIR 268
            .:.....|..|......||:...|||   :.:|        |...:|||.|.|:.|:||||||.|
pombe   260 KLFSTGADDCICLHPTPSSIADDLGS---LPHPIFRKTKHCGQQNIRIRSDNKILATAGWDGRGR 321

  Fly   269 IFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVAMWH--APIMAAAGMDGQISLWDLY 322
            ::|.::|.|||||..|.: |:..|||        |  :.::|.|..|.:||||.||
pombe   322 VYSCQTLAPLAVLKYHSD-GINSLAF--------HPGSNVIALASKDTRISLWKLY 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 101/379 (27%)
WD40 repeat 62..98 CDD:293791 10/68 (15%)
WD40 repeat 103..147 CDD:293791 11/51 (22%)
WD40 repeat 200..245 CDD:293791 11/53 (21%)
WD40 201..>321 CDD:295369 45/130 (35%)
WD40 repeat 247..282 CDD:293791 20/35 (57%)
asa1NP_594849.1 WD40 1..>367 CDD:225201 101/379 (27%)
WD40 9..366 CDD:295369 99/373 (27%)
WD40 repeat 199..233 CDD:293791 12/34 (35%)
WD40 repeat 300..336 CDD:293791 20/36 (56%)
WD40 repeat 341..367 CDD:293791 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1842
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004983
OrthoInspector 1 1.000 T1124583
orthoMCL 1 0.900 OOG5_131248
Panther 1 1.100 LDO PTHR19854
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R93
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.