DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13192 and mec-15

DIOPT Version :9

Sequence 1:NP_610702.1 Gene:CG13192 / 36259 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_496207.1 Gene:mec-15 / 174587 WormBaseID:WBGene00003177 Length:406 Species:Caenorhabditis elegans


Alignment Length:148 Identity:30/148 - (20%)
Similarity:55/148 - (37%) Gaps:51/148 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LCFQESDR--LLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHTPDRLVTQEKGGTITMFSI 85
            :.|:.:::  .|:|:...::.||.::..|:      |.|             |::...|:     
 Worm   110 MLFENNNKQFCLSGSRDRTIRLWSIENARN------GED-------------TEQNPWTV----- 150

  Fly    86 GGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYPCE-ESSIGVLHVTDAAAPTQILVPDDP 149
                 .|:.:.   |.|:..:....:|| ||    ||... :|::...|:||..|          
 Worm   151 -----AKDDTA---HSGWIWNMAQESTS-TN----FYTTSWDSTVKSWHITDNGA---------- 192

  Fly   150 QLPKLGSVTCFKPFECAS 167
             |..|.||......:|.|
 Worm   193 -LQNLNSVNVGSAAQCIS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 30/148 (20%)
WD40 repeat 62..98 CDD:293791 3/35 (9%)
WD40 repeat 103..147 CDD:293791 11/44 (25%)
WD40 repeat 200..245 CDD:293791
WD40 201..>321 CDD:295369
WD40 repeat 247..282 CDD:293791
mec-15NP_496207.1 F-box-like 9..52 CDD:315592
WD40 88..322 CDD:330360 30/148 (20%)
WD40 repeat 106..154 CDD:293791 11/72 (15%)
WD40 repeat 162..197 CDD:293791 12/50 (24%)
WD40 repeat 204..241 CDD:293791 2/6 (33%)
WD40 repeat 247..286 CDD:293791
WD40 repeat 290..310 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.