DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13192 and mec-15

DIOPT Version :10

Sequence 1:NP_610702.1 Gene:CG13192 / 36259 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_496207.1 Gene:mec-15 / 174587 WormBaseID:WBGene00003177 Length:406 Species:Caenorhabditis elegans


Alignment Length:148 Identity:30/148 - (20%)
Similarity:55/148 - (37%) Gaps:51/148 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LCFQESDR--LLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHTPDRLVTQEKGGTITMFSI 85
            :.|:.:::  .|:|:...::.||.::..|:      |.|             |::...|:     
 Worm   110 MLFENNNKQFCLSGSRDRTIRLWSIENARN------GED-------------TEQNPWTV----- 150

  Fly    86 GGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYPCE-ESSIGVLHVTDAAAPTQILVPDDP 149
                 .|:.:.   |.|:..:....:|| ||    ||... :|::...|:||..|          
 Worm   151 -----AKDDTA---HSGWIWNMAQESTS-TN----FYTTSWDSTVKSWHITDNGA---------- 192

  Fly   150 QLPKLGSVTCFKPFECAS 167
             |..|.||......:|.|
 Worm   193 -LQNLNSVNVGSAAQCIS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <18..321 CDD:441893 30/148 (20%)
WD40 repeat 62..98 CDD:293791 3/35 (9%)
WD40 repeat 103..147 CDD:293791 11/44 (25%)
WD40 repeat 200..245 CDD:293791
WD40 repeat 247..282 CDD:293791
mec-15NP_496207.1 F-box_SF 9..57 CDD:459239
WD40 88..322 CDD:475233 30/148 (20%)
WD40 repeat 106..154 CDD:293791 11/72 (15%)
WD40 repeat 162..197 CDD:293791 12/50 (24%)
WD40 repeat 204..241 CDD:293791 2/6 (33%)
WD40 repeat 247..286 CDD:293791
WD40 repeat 290..310 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.