DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13192 and gnb1l

Sequence 1:NP_610702.1 Gene:CG13192 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001120042.1 Gene:gnb1l XenbaseID:XB-GENE-1010503 Length:327 Species:Xenopus tropicalis

Alignment Length:347 Identity:105/348 (30%)
Similarity:161/348 (46%) Gaps:48/348 (14%)


  Fly     1 MAVLPPDPVFSLRSPDMGAVNSLCFQ------ESDRLLAGTIKGSVFLWDLQTNRSA-------- 51
            ||:..|||.|.||..| ..||||.|.      ....|.:|:..|.|.:|:|.|.||.        
 Frog     1 MALPSPDPKFDLRGID-AEVNSLHFSCMVQRPSQPLLFSGSSNGLVHVWNLNTRRSETVLSGHQG 64

  Fly    52 -----LHFEVGSDPITSLHHTPDRLVTQEKGGTITMFSIGGSSYVKERSIPGNHLGFCRSALHTN 111
                 ||         :|.|..:.|::|.:...|..:::......:..|:|...:|||:.:|   
 Frog    65 KSIYWLH---------TLFHNRELLLSQGRDLQIRTWNLAEGRREEIDSVPVESVGFCKCSL--- 117

  Fly   112 TSKTNEQLLFYPCEESS-IGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFK---PFECASQLFLL 172
             .||...||..|.::|| :.||.:......:.:.:..|.|   .|...|.|   |....|.| ||
 Frog   118 -LKTESCLLAMPGKDSSQVQVLDLNSKKIVSSMKLSTDNQ---WGMAMCMKLWQPISGPSPL-LL 177

  Fly   173 AGYESGHFLTWDISSSVILDVMEL-AQDATSVDYDPVTNRGIVGGPTDKLISFSY-QRSSMQMQL 235
            .|||.|....|::....::..:.. .:...|:|:|.:..||..|.....|..:|. ::.:::...
 Frog   178 VGYEDGSVALWNVLEHRLMSRLTCHMEPVMSLDFDCLKARGASGSSERVLNVWSLDEQQNLKAYK 242

  Fly   236 GSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVA 300
            ..||.  |||::.|.:|.|:|:.|:||||.|||:|.||.::||||| |:.:..|..::||.....
 Frog   243 TQELV--NPGISDVVLRQDRKILATAGWDHRIRVFGWKRMKPLAVL-QYHSAIVHCVSFSDHLTP 304

  Fly   301 MWHAPIMAAAGMDGQISLWDLY 322
              ...::||...|..||||.:|
 Frog   305 --EDRLLAAGSKDHLISLWSVY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 102/341 (30%)
WD40 repeat 62..98 CDD:293791 7/36 (19%)
WD40 repeat 103..147 CDD:293791 12/45 (27%)
WD40 repeat 200..245 CDD:293791 12/46 (26%)
WD40 201..>321 CDD:295369 44/121 (36%)
WD40 repeat 247..282 CDD:293791 20/35 (57%)
gnb1lNP_001120042.1 WD40 12..>326 CDD:225201 99/337 (29%)
WD40 12..322 CDD:295369 98/333 (29%)
WD40 repeat 70..107 CDD:293791 9/46 (20%)
WD40 repeat 112..150 CDD:293791 12/42 (29%)
WD40 repeat 159..200 CDD:293791 12/42 (29%)
WD40 repeat 206..242 CDD:293791 8/36 (22%)
WD40 repeat 251..287 CDD:293791 20/37 (54%)
WD40 repeat 293..321 CDD:293791 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0322
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41515
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1543596at2759
OrthoFinder 1 1.000 FOG0004983
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.