| Sequence 1: | NP_610694.1 | Gene: | Tret1-2 / 36249 | FlyBaseID: | FBgn0033644 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012321.1 | Gene: | HXT8 / 853216 | SGDID: | S000003750 | Length: | 569 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 515 | Identity: | 129/515 - (25%) |
|---|---|---|---|
| Similarity: | 222/515 - (43%) | Gaps: | 58/515 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 SVPADGLKANFTFSQ-----------------VLAALSV-SLCSLVVGFVSAY---TSPALVSMT 57
Fly 58 D--RTITSFEVTKDA-------GSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSS 113
Fly 114 LL-IACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTL----GLLPTALGNIGILV 173
Fly 174 CYVAGSFMN---WSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEAD-- 233
Fly 234 -VEPELKELMQSQADADRQATQNTCLELFKRNN--LKPLSISLGLMFFQQFSGINAVIFYTVQIF 295
Fly 296 KDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAH-- 358
Fly 359 ---GPDVSHLG--WLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFV 418
Fly 419 VTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIERKMM-GRVPMSS 477 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tret1-2 | NP_610694.1 | Sugar_tr | 31..467 | CDD:278511 | 119/468 (25%) |
| MFS | 33..454 | CDD:119392 | 109/453 (24%) | ||
| HXT8 | NP_012321.1 | Sugar_tr | 69..530 | CDD:395036 | 117/465 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C157342783 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0254 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100060 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X26 | |
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.640 | |||||