DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and CG5592

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:455 Identity:96/455 - (21%)
Similarity:185/455 - (40%) Gaps:118/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTI-LATAVPFIVSSLLIACAVNVIMILCGRFL 131
            :|.|::...:..:..:.|.:..|.:.::.||...: ||.:...|...:.:.|. :.......||:
  Fly   136 RDFGTYSVVVYFVGCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCK-DFPCFAASRFV 199

  Fly   132 TG----FCVGIASLSLPVYLGETLQPEVRGTLGL-LPTALGNIGILVCYVAGSFM---------N 182
            .|    :|.      :|:|: .||:     .:|: ..|.:||:.:...:..|:.:         |
  Fly   200 AGLSMNYCF------VPIYI-LTLE-----NVGIKYRTLVGNLALTFFFTLGACLLPWLAYVISN 252

  Fly   183 WSMLAFLGAALPVPFLIL-MIIIPETPRWFVNRGQEERARKALK---WLRGK--EADVEPELKEL 241
            |...|.: .|||:.|:|| .::.||:|.|.::.|:.:|..:.:|   ...||  ..:|..|::|.
  Fly   253 WRHYAMV-VALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISEEVWSEMREC 316

  Fly   242 MQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNL 306
            .:.:...::...|.|.|:|||   ..|..:.|.::.         |.:.||.:..||...:...|
  Fly   317 YELKFANEQLGKQYTSLDLFK---TFPRLVVLTILI---------VTWMTVALAYDAHVRVVEIL 369

  Fly   307 STIIV------GVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFF--YCKAHGPDVS 363
            .|.|.      .:|...|..:.::|:||:|||.::     :.::.|......|  ..|.|     
  Fly   370 DTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMM-----SAVMLLCAASSLFVGILKGH----- 424

  Fly   364 HLGWLPLTCFV----IYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQ 424
               |...|..:    ...:.:::|   ..|  ..||||..:||...:::.               
  Fly   425 ---WNASTAAIAARFFATMAYNVG---QQW--ASEILPTVLRGQGLAIIN--------------- 466

  Fly   425 DLTVAMGAHGA-----------------FWLFGAICIVGLFFVIIFVPETRG----KSLEEIERK 468
                .||..||                 .::...:.::|. .:|:|:|||:|    ::|:|.|::
  Fly   467 ----IMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGA-LIILFLPETKGATMPQTLDEAEKR 526

  Fly   469  468
              Fly   527  526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 95/452 (21%)
MFS 33..454 CDD:119392 88/435 (20%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 93/446 (21%)
MFS 141..509 CDD:119392 87/431 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.