| Sequence 1: | NP_610694.1 | Gene: | Tret1-2 / 36249 | FlyBaseID: | FBgn0033644 | Length: | 488 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001361998.1 | Gene: | K09C4.4 / 187194 | WormBaseID: | WBGene00019549 | Length: | 524 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 524 | Identity: | 121/524 - (23%) | 
|---|---|---|---|
| Similarity: | 190/524 - (36%) | Gaps: | 181/524 - (34%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    43 GFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAV 107 
  Fly   108 PFIVSSLLIACAVNVIMILC--------------------------GRFLTGFCV---------G 137 
  Fly   138 IASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMI 202 
  Fly   203 I--IPETPRWFVNRGQEERARKALKWLRG---------------KEADVEPE----LKELMQSQA 246 
  Fly   247 DADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLS-TII 310 
  Fly   311 VGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVI 375 
  Fly   376 YILGFS------------LGFGP-------IPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTK 421 
  Fly   422 TFQDLTVAMGAHGAF-----W----LFGAICIVGLFFVII---FVPETRGKSLEEIERKMMGRVP 474 
  Fly   475 MSSV 478  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Tret1-2 | NP_610694.1 | Sugar_tr | 31..467 | CDD:278511 | 118/511 (23%) | 
| MFS | 33..454 | CDD:119392 | 113/498 (23%) | ||
| K09C4.4 | NP_001361998.1 | MFS | 42..462 | CDD:391944 | 116/504 (23%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160158122 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D524131at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.850 | |||||