powered by:
Protein Alignment Tret1-2 and armh4
DIOPT Version :9
Sequence 1: | NP_610694.1 |
Gene: | Tret1-2 / 36249 |
FlyBaseID: | FBgn0033644 |
Length: | 488 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002933775.1 |
Gene: | armh4 / 100497155 |
XenbaseID: | XB-GENE-6468333 |
Length: | 666 |
Species: | Xenopus tropicalis |
Alignment Length: | 70 |
Identity: | 17/70 - (24%) |
Similarity: | 25/70 - (35%) |
Gaps: | 25/70 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 EVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGR 129
|..||...::.|: |..:..|:.| :|||..|:..|.|:..|
Frog 594 EKLKDKAGYMSGM--LIPVGVGVAG-----------------------ALLILGALYSIKIMNRR 633
Fly 130 FLTGF 134
..|||
Frog 634 RRTGF 638
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tret1-2 | NP_610694.1 |
Sugar_tr |
31..467 |
CDD:278511 |
17/70 (24%) |
MFS |
33..454 |
CDD:119392 |
17/70 (24%) |
armh4 | XP_002933775.1 |
DUF4696 |
<113..>277 |
CDD:374091 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165163585 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.