DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and armh4

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_002933775.1 Gene:armh4 / 100497155 XenbaseID:XB-GENE-6468333 Length:666 Species:Xenopus tropicalis


Alignment Length:70 Identity:17/70 - (24%)
Similarity:25/70 - (35%) Gaps:25/70 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGR 129
            |..||...::.|:  |..:..|:.|                       :|||..|:..|.|:..|
 Frog   594 EKLKDKAGYMSGM--LIPVGVGVAG-----------------------ALLILGALYSIKIMNRR 633

  Fly   130 FLTGF 134
            ..|||
 Frog   634 RRTGF 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 17/70 (24%)
MFS 33..454 CDD:119392 17/70 (24%)
armh4XP_002933775.1 DUF4696 <113..>277 CDD:374091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165163585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.