DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and slc2a13

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_004913061.2 Gene:slc2a13 / 100485871 XenbaseID:XB-GENE-492054 Length:646 Species:Xenopus tropicalis


Alignment Length:538 Identity:139/538 - (25%)
Similarity:230/538 - (42%) Gaps:107/538 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VSLCSLVVGFVSAY-----TSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIE 94
            ||:.|.:.||:..|     :...|:...:..:::........|.||. ..|:|||||:..|    
 Frog    82 VSVFSALGGFLFGYDTGVVSGAMLLLKREMNLSALWQELLVSSTVGA-AALSALAGGVLNG---- 141

  Fly    95 YLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTL 159
            .||||..||..::.|...::::|.|.:...:|.||.:.|..:||||:::|||:.|...|.:||.|
 Frog   142 VLGRRPCILMASLLFTAGAVILAAARDKETLLGGRVVVGLGIGIASMTVPVYIAEAAPPHLRGRL 206

  Fly   160 GLLPTAL---GNIGILVCYVAGSFM---NWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEE 218
            ..:.|..   |.....|...|.|::   .|..:..|.|...|...:..:.:||:|||.:.:||.:
 Frog   207 VTINTLFITGGQFSAAVVDGAFSYLARDGWRYMLGLSAVPAVLQFLGFLFLPESPRWLIQKGQTQ 271

  Fly   219 RARKALKWLRGKEADVEPELKELMQSQADADRQ-ATQNTCL--ELFKRNNLKPLSISLGLMFFQQ 280
            :||:.|..:||.:. ::.|...:..|..:.::: ||....:  .|......:.|.:..||..|||
 Frog   272 KARRVLSQIRGNQT-IDEEYDSIKNSIDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQ 335

  Fly   281 FSGINAVIFYTVQIFKDAGSTIDSNLSTI----IVGVVNFFATFMGIILIDRLGRKILLYVSDIA 341
            .:|||.|::|:..|.:.:|  :|.:...|    :....||..|.:|:.|:::|||:.|...|...
 Frog   336 LAGINTVMYYSATILQMSG--VDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTG 398

  Fly   342 MIVTLSILG-GFF---------------------------YC-------------KAHGPDV--- 362
            ..|.|.:|. ||.                           ||             |.:|..:   
 Frog   399 TTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQYSYCNKCMLDPNCGFCYKKNGSSIVDS 463

  Fly   363 -------------------------------------SHLGWLPLTCFVIYILGFSLGFGPIPWL 390
                                                 :...|..|...::|::.|:.|.||:||.
 Frog   464 SCIPVNTESTDRAAWGRCMNETKSKAGGSIWAYNYCPTSYSWTALLGLILYLVFFAPGMGPMPWT 528

  Fly   391 MMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVP 455
            :..||.|...|....:..:..||.|..:::.||......:..:|||:|:..:..|||.|:...:|
 Frog   529 VNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLACVGLIFIYGCLP 593

  Fly   456 ETRGKSLEEIERKMMGRV 473
            ||:||.|||||.....|:
 Frog   594 ETKGKKLEEIESLFESRL 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 137/530 (26%)
MFS 33..454 CDD:119392 128/517 (25%)
slc2a13XP_004913061.2 MFS_HMIT_like 85..594 CDD:340918 126/516 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.