DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tret1-1 and CG33282

Sequence 1:NP_610693.1 Gene:Tret1-1 FlyBaseID:FBgn0050035 Length:857 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:448 Identity:128/449 (29%)
Similarity:216/449 (48%) Gaps:15/449 (3%)


  Fly   396 QVLAALSVSLGSLVVGFVSAYTSPALVSM-TDRNITSFEVTQDAGSWVGGIMPLAGLAGGIAGGP 459
            |:||.:.|::.:...|....:.||.|..: |..:...|||.....||:|.::.|..|.|.:....
  Fly    17 QLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAM 81

  Fly   460 LIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLCGRFLAGFCVGIASLSLPVYLGETVQPEVR 524
            |||..||:..:...|.|:....:||.||.||..:...|||.||..|...|.:|:::.|.....:|
  Fly    82 LIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIR 146

  Fly   525 GTLGLLPTAFGNIGILLCFVAGSFMNWSMLAFLGAALPVPFLILMFLIPETPRWFVGRGLEERAR 589
            |.|..:.....::|||..::..:::.:.::.||...|||.:.|...::|||..:.:.:.....|.
  Fly   147 GALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAE 211

  Fly   590 KALKWLRGKEADV--------EPELKGLMRSQADADRQASRNTMLELLKLNNLKPLSISLGLMFF 646
            .:.::.|.:.:.:        ..||:..:.||  ..|.|:..:..:|.....||..:.|:.|...
  Fly   212 NSFRYYRNQRSAICEQTSKVNFEELRTAVLSQ--QTRNATPLSYKDLTTKPALKGFAASIVLSLG 274

  Fly   647 QQFSGINAVIFYTVQIFKDAGSTIDGNLCTIIVGIVNFLATFIGIVLIDRAGRKILLYVSDIAMV 711
            .||||:.:.|.|...|||.:||.:|.|..|||:|:|..:..:...:|:|..||::|:.:|.:.:.
  Fly   275 YQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVG 339

  Fly   712 LTLFVLGGFFY-CKTYGPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASV 775
            :.....|.|.| .|.|  |:|...||||...:|.....::|...|.:|::.|:.|.|||..|.|:
  Fly   340 IGCIAFGCFTYLAKIY--DLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSL 402

  Fly   776 ATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVIIYVPETQGKT-LED 832
            :..|.....|...|.|..:....|.....|...|...:..|:..:::.||:||: :||
  Fly   403 SVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIED 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tret1-1NP_610693.1 SP 382..833 CDD:273317 128/449 (29%)
MFS 401..822 CDD:119392 119/431 (28%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 119/431 (28%)
MFS_1 53..409 CDD:284993 106/360 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85815206
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000041
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23500
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.