DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and HDG3

DIOPT Version :10

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_180796.2 Gene:HDG3 / 817798 AraportID:AT2G32370 Length:725 Species:Arabidopsis thaliana


Alignment Length:115 Identity:29/115 - (25%)
Similarity:51/115 - (44%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 DSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTA 460
            |||.:..|...:.:|:.....|.|:                 .||:::.|..:            
plant    39 DSGDQDFDSGNTSSGNHGEGLGNNQ-----------------APRHKKKKYNR------------ 74

  Fly   461 FSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIK 510
            .:..|::.::..|.|..:..:::|..||::|||:..|||.||||||.:.|
plant    75 HTQLQISEMEAFFRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKRTQNK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeodomain 455..511 CDD:459649 19/56 (34%)
Engrail_1_C_sig 512..542 CDD:431338
HDG3NP_180796.2 Homeodomain 69..125 CDD:459649 20/68 (29%)
ClpA <119..>206 CDD:440308 3/6 (50%)
START_ArGLABRA2_like 247..471 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.