DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HDG10

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_174724.1 Gene:HDG10 / 840369 AraportID:AT1G34650 Length:708 Species:Arabidopsis thaliana


Alignment Length:79 Identity:26/79 - (32%)
Similarity:44/79 - (55%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 AADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKL 526
            ::|..|:  |...|...|..|:.||:..|:|..:..:.:|:||..||.|...|||.||||:|.:.
plant     9 SSDEEGI--DSNNRRHHSNHQVQRLEAFFHECPHPDDSQRRQLGNELNLKHKQIKFWFQNRRTQA 71

  Fly   527 KKSSGTKNPLALQL 540
            :..:...:.:||::
plant    72 RIHNEKADNIALRV 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 21/55 (38%)
Engrail_1_C_sig 529..554 CDD:431338 2/12 (17%)
HDG10NP_174724.1 Homeodomain 20..72 CDD:459649 21/51 (41%)
START_ArGLABRA2_like 222..452 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.