DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Gsx1

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001178592.1 Gene:Gsx1 / 288457 RGDID:1310020 Length:261 Species:Rattus norvegicus


Alignment Length:67 Identity:33/67 - (49%)
Similarity:43/67 - (64%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 VPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGT 532
            :|..||.||||:.|||..|:.||..|.||:..||.:::..|.|:|.|:||||||:|.|.||....
  Rat   143 LPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKG 207

  Fly   533 KN 534
            .|
  Rat   208 SN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 29/55 (53%)
Engrail_1_C_sig 529..554 CDD:431338 1/6 (17%)
Gsx1NP_001178592.1 Homeodomain 147..203 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.