DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Vax1

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:190 Identity:55/190 - (28%)
Similarity:80/190 - (42%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 NSTATSSSTTNTSGA-PVDLVKSPPPA-AGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSS 431
            |:...|.......|: |...:|.|..| :|:||:....||..:|...   |.  ||.|...|.:.
Mouse    24 NAHKESREIKGAEGSLPAAFLKEPQGAFSGSGASEDCNKSKSNSSAD---PD--YCRRILVRDAK 83

  Fly   432 GRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYL 496
            |.......||                       |..:...||.||:|:..||.||:.||...:|:
Mouse    84 GSIREIILPK-----------------------GLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYV 125

  Fly   497 TEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPL------------ALQLMAQG 544
            ..:.|.:|:.:|.|:|.|:|:||||:|.|.||..|..:.|            .|:|:.||
Mouse   126 VGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 25/55 (45%)
Engrail_1_C_sig 529..554 CDD:431338 6/28 (21%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 13/44 (30%)
Homeodomain 101..157 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.