DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Dlx4

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:64 Identity:31/64 - (48%)
Similarity:41/64 - (64%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAK----LKKSSG 531
            ::|||.:|..||..|...|...:||....|.||:.:|||.:.|:||||||||:|    ||:|||
Mouse   117 RKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 27/59 (46%)
Engrail_1_C_sig 529..554 CDD:431338 3/3 (100%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
Homeodomain 117..173 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 5/6 (83%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.