DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and CPHXL2

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001382791.1 Gene:CPHXL2 / 112268164 HGNCID:55919 Length:400 Species:Homo sapiens


Alignment Length:110 Identity:31/110 - (28%)
Similarity:40/110 - (36%) Gaps:27/110 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 RTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQ 539
            |..||...|..||..|.||.|.....|:.|:.:.......|..||||.||:|...          
Human    28 RH
KFSEELLQELKEIFGENGYPDFTTRKTLANKFDCPVNVINNWFQNNRARLPPE---------- 82

  Fly   540 LMAQGLYNHSTIPLTREEEE----------LQELQEAASAAAAKE 574
                   ....|.||.::.:          |||.|.|||..|.::
Human    83 -------ERQRIFLTWKKHDFPVQACPFLSLQETQAAASNYATEQ 120

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 20/52 (38%)
Engrail_1_C_sig 529..554 CDD:431338 1/24 (4%)