DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and prss3

DIOPT Version :10

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004941.1 Gene:prss3 / 448342 XenbaseID:XB-GENE-6372192 Length:249 Species:Xenopus tropicalis


Alignment Length:43 Identity:9/43 - (20%)
Similarity:18/43 - (41%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PSTPFANVSTGQNE----SLANLLLHPGVHQLSSGLVTLVGDI 130
            |..|.......:.|    |:|.:.:...::|.|:|..::...|
 Frog    45 PGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 9/43 (21%)
prss3NP_001004941.1 Tryp_SPc 23..245 CDD:238113 9/43 (21%)

Return to query results.
Submit another query.