DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Tmprss11b

DIOPT Version :10

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:136 Identity:30/136 - (22%)
Similarity:50/136 - (36%) Gaps:33/136 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 HVREGSVY---FQRSSTFNHHNGHQRN-------LNPHIKFSNSHSNLPEEISLMSLEKDLRSLD 544
            |:|..|.:   .|.||:|:.....|..       ..|...||::.|:  |:.::.|::     ||
Mouse   931 HLRRVSPWQCRDQNSSSFSIGTPSQSESRSASSLARPEDNFSDTGSS--EDQTIFSMD-----LD 988

  Fly   545 ENVNQIHQKGGGGGGGGGGG----------------GGGVGGGIGLSLGGAAGVDGSRRIKRRSF 593
            ...:|:..:....|||...|                .|..|..|.:||.....:||....:.:..
Mouse   989 GGSSQVLPRKERQGGGSSSGAPSECSFESDIPVAALNGKRGSLIEISLSSLKALDGEEADQSQDI 1053

  Fly   594 ASKFLS 599
            .|..:|
Mouse  1054 FSDSMS 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473
Tmprss11bNP_795998.2 SEA 46..143 CDD:460188
Tryp_SPc 185..413 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.