DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and tmprss5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:256 Identity:95/256 - (37%)
Similarity:133/256 - (51%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            ||:||....:.:.|:|:||.|..        ||.|||||.....||||||||     ..|::...
Zfish   311 RIIGGVEAALGRWPWQVSLYYNN--------RHICGGSIITNQWIVTAAHCV-----HNYRLPQV 362

  Fly   103 TNFQTGSDGVITNVKEIVMHEGY----------YSGAAYNNDIAILFVDPPLPLNNF--TIKAIK 155
            .::...:..:.:|:.::..::|:          |:...::||||::.:..||   ||  ||:.:.
Zfish   363 PSWVVYAGIITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPL---NFSDTIRPVC 424

  Fly   156 LAL---EQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRITSAM 216
            |..   :.| .||...:||||.|.|......::| ...||::|.:.|:......|:    |||.|
Zfish   425 LPQYDHDLP-GGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGE----ITSRM 484

  Fly   217 LCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            |||| ...|..|||||||||||..:||    |.||||||..||.||:||||:.||....||
Zfish   485 LCAG-YSEGKVDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 93/254 (37%)
Tryp_SPc 39..276 CDD:238113 94/255 (37%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 93/254 (37%)
Tryp_SPc 312..547 CDD:238113 94/255 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.