DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:283 Identity:98/283 - (34%)
Similarity:137/283 - (48%) Gaps:41/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            |..:::.||.....|    .|:    |.:|||||..:...||||:||         |...|.|||
Human     3 LLLILTFVAAAVAAP----FDD----DDKIVGGYICEENSVPYQVSL---------NSGYHFCGG 50

  Fly    75 SIFNETTIVTAAHCVIGTVAS----------QYKVVAGT-NFQT--GSDGVITNVKEIVMHEGYY 126
            |:.:|..:|:|.||....:.|          :.:|..|. |.:.  |::..| |..:|:.|..|.
Human    51 SLISEQWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFI-NAAKIIRHPKYN 114

  Fly   127 SGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTT-SPGGYSSNQLLAVDV 190
            | ...:|||.::.:..|..:|: .:.||.|....|..||.|.:||||.| |.|....::|..:|.
Human   115 S-RTLDNDILLIKLSSPAVINS-RVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDA 177

  Fly   191 PIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCA 255
            |::|...|:..|..      :||:.|.|.|.. .||.|:||||||||:....||.|:||||..||
Human   178 PVLSQAECEASYPG------KITNNMFCVGFL-EGGKDSCQGDSGGPVVSNGELQGIVSWGYGCA 235

  Fly   256 LPNYPGVYANVAYLRPWIDAVLA 278
            ..|.||||..|.....||...:|
Human   236 QKNRPGVYTKVYNYVDWIKDTIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/248 (36%)
Tryp_SPc 39..276 CDD:238113 91/250 (36%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 89/248 (36%)
Tryp_SPc 24..256 CDD:238113 91/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.