DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss4

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:287 Identity:90/287 - (31%)
Similarity:124/287 - (43%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            ||||..|..|         ||:...|:|||........|:|:|::|..        :|.|||||.
  Rat   229 LVSLRCLDCG---------KSLKTTRVVGGVEASADSWPWQVSIQYNK--------QHVCGGSIL 276

  Fly    78 NETTIVTAAHCVIGTV-ASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVD 141
            :...|:|||||....: .|.:||.||:|....|..:                     .:|.:|:.
  Rat   277 DHHWILTAAHCFRKYLDVSSWKVRAGSNKLGNSPSL---------------------PVAKIFIA 320

  Fly   142 PPLPL--NNFTIKAIKLALEQPIEGTVSK-----------------VSGWG-TTSPGGYSSNQLL 186
            .|.||  ....|..:||.:.....|:|..                 |.||| |...||..|:.||
  Rat   321 EPNPLQPKEKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVIGWGFTEENGGKMSDTLL 385

  Fly   187 AVDVPIVSNELCDQDYEDFGDETYR--ITSAMLCAGKRGVGGADACQGDSGGPLAV---RDELYG 246
            ...|.::.:..|:      .::.|:  :|:.||||| ...||.|.|||||||||..   :.::.|
  Rat   386 QASVQVIDSARCN------AEDAYQGEVTAGMLCAG-TPQGGKDTCQGDSGGPLMYHYDKWQVVG 443

  Fly   247 VVSWGNSCALPNYPGVYANVAYLRPWI 273
            :||||..|..|:.||||..|.....||
  Rat   444 IVSWGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 80/260 (31%)
Tryp_SPc 39..276 CDD:238113 81/261 (31%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 5/8 (63%)
Tryp_SPc 245..470 CDD:214473 80/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.